Mechanisms of Connexin Regulating Peptides
Abstract
:1. Introduction
Gap Junctions, Hemichannels, and Connexin Proteins as Therapeutic Targets
2. Indirect Acting Peptides That Alter GJs and Connexins
Year | Peptide | Sequence/Formula | Known Target Cx | Linker | Properties | Increase Cx43-PKC | Refs. | |
---|---|---|---|---|---|---|---|---|
Cx | Region | |||||||
Non-Mimetic Peptides—Indirect Effects | ||||||||
1980 | AAP10 | H-GAG-4hyp-PY-CONH | Cx43 * Cx40 * | Indirect: Unknown GPCR pathway | - | Increases Cx synthesis, expression, phosphorylation, membrane targeting, and GJ opening | Y | [58,72,76,77,84] |
2003 | Rotagaptide (ZP123) | H2N-GDAGD-4hyp-DPDY-Ac | Cx43 * | NT Acetyl | Y | [51] | ||
2013 | Danegaptide (ZP1609, GAP134) | C14H17N3O4 | Cx43 * | - | Y | [69,74] | ||
Extracellular Loop 1 (EL1) | ||||||||
1997 | Gap26 | VCYDKSFPISHVR | Cx43, Cx32, Cx26 | 64–76 | - | HC block | Y | [92,93] |
2001 | 43Gap26 | VCYDKSFPISHVR | Cx43 | 64–76 | - | HC block | Y | [94,95] |
2009 | 43Gap26M | VCYDKSFPISHVR | Cx43 | 64–76 | NT Acetyl | HC block | Y | [95,96] |
2001 | 37,40Gap26 | VCYDQAFPISHIR | Cx37, Cx40 | 64–76 | - | HC block | ND | [94] |
1999 | Unlabelled | ICNTLQPGCNSV | Cx32 | 52–63 | - | GJ block | ND | [97] |
2007 | Peptide 1848 | CNTQQPCCENVCY | Cx43 | 54–66 | - | GJ Block | ND | [98] |
Extracellular Loop 2 (EL2) | ||||||||
1999 | Unlabelled | SLSAVYTCKRDPCPHE | Cx43 | 180–195 | - | GJ block | ND | [99] |
1999 | Unlabelled | FLDTLHVCRRSPCPHP | Cx40 | 177–192 | - | GJ block | ND | [99] |
2001 | 37,43Gap27 | SRPTEKTIFII | Cx43, Cx37, Cx32, Cx26 | 201–211 | - | HC block | Y | [92,93,94,95,100] |
2001 | 40Gap27 | SRPTEKNVFIV | Cx40 | 201–211 | - | GJ block | ND | [93,94,100] |
2011 | 32Gap27 | SRPTEKTVFT | Cx32 | 182–191 | - | HC block | ND | [101] |
2021 | 62Gap27 | SRPTEKTIFML | CX62 | 201–211 | - | HC & GJ block | ND | [102] |
2008 | Peptide 5 | VDCFLSRPTEKT | EL2 | EL2 | s-lipidation | HC & GJ block | ND | [103,104,105,106] |
2013 | SRPTEKT/GAP21 | SRPTEKT | Cx32 Cx43 | 182–188 204–210 | - | HC block | ND | [92,101] |
2018 | SRPTEKT-Hdc (Gap21) | SRPTEKT-Hdc | Cx43 | EL2 | Hexadecyl (HC) lipid moeity | HC & GJ block | Y | [107,108] |
2013 | C12-Cx43 MP and C12-C12-Cx43 MP | C12-VDCFLSRPTEKT C12-C12-VDCFLSRPTEKT | Cx43 | 199–210 | 1/2 C12-Laa moieties | HC block | ND | [109] |
Intracellular Loop (IL) | ||||||||
2006 | 32GAP24 TAT-GAP24 | GHGDPLHLEEVKC YGRKKRRQRRRGHGDPLHLEEVKC | Cx32 Cx43 Panx1 | 110–122 | +/− TAT | HC block Inhibit GJ formation | ND | [10,110,111] |
2004 | L2 (Cx43L2) | DGVNVEMHLKQIEIKKFKYGIEEHGK | Cx43 | 119–142 | - | HC block, not GJ GJ block | ND | [42,112,113] |
2010 | TAT-L2 | TAT-DGANVDMHLKQIEIKKFKYGIEEHGK | Cx43 | 119–142 | TAT | HC block | ND | [114] |
2013 | Gap19 | KQIEIKKFK | Cx43 | 128–136 | - | HC block | ND | [111,115,116] |
2014 | TAT-Gap19 | KQIEIKKFK | Cx43 | 128–136 | TAT | HC block | ND | [117] |
2020 | Xentry-Gap19 | KQIEIKKFK | Cx43 | 128–136 | LCLRPV | HC block | [118] | |
2010 | TAT-Cx50L2 | GGERAPLAADQGSVKKSSSSSKGTKK | Cx50 | 122–147 | TAT | ND Cx50, No effect on Cx43 HC | ND | [114] |
Gap 20 | EIKKFKYGC | Cx43 | 131–138 | - | No effect | ND | [119] | |
Gap 22 | AELSCNKEVNG | Cx40 | 130–140 | - | No effect | ND | [92] | |
N-terminus/C-terminus | ||||||||
2005 | Alpha CT1 | RPRPDDLEI | Cx43 | 374–382 | Antenna-pedia | Promotes GJ formation, enhance GJ, HC block | Y | [120,121,122] |
2009 | Alpha CT11 aka (Alpha CT2) | RPRPDDLEI | Cx43 | 374–382 | None | Promotes GJ formation, enhance GJ, HC block | Y | [122,123] |
2009 | Alpha CT3 | RQPKIWFPNRRKPWKKRPSSRASSRASSRPRPDDLEI | Cx43 | 359–382 | Antenna-pedia | ND | ND | [122] |
2010 | TAT-Cx43CT | SRPRPDDLEI | Cx43 | 373–382 | TAT | Maintains open channel and permits dye transfer. Inhibits HC block | ND | [114] |
2011 | CT9 | RPRPDDLEI | Cx43 | 374–382 | +/− TAT | HC block | Y | [101,124,125] |
2013 | TAT-CT10 | SRPRPDDLEI | Cx43 | 373–382 | TAT | Inhibits the effect of CxL2 peptides—stops L2 hemichannel blockade | ND | [115] |
2010 | TAT-Cx50CT | SRARSDDLTV | Cx50 | 431–440 | TAT | ND–Cx50, No effect on Cx43 HC | ND | [114] |
2010 | ZP2519 | AcRRK-(4 hydroxy benzoyl) | Cx43 C-term | - | - | GJ opening | ND | [126] |
2015 | Juxtamembrane 2 (JM2) | VFFK-GVKDRVKGRSD | Cx43 | 231–245 | Antenna-pedia | HC block | ND | [127] |
2020 | TAT-Cx43 266–283 | AYFNGCSSPTAPLSPMSP | Cx43 | 266–283 | TAT | ND | ND | [128,129] |
3. Connexin-Mimetic Peptides
3.1. Connexin-Mimetic Peptides That Target the Extracellular Loops
3.2. Connexin Mimetic Peptides That Target the Intracellular Loop
3.3. Connexin-Mimetic Peptides That Target the Carboxyl-Terminus
3.3.1. α. CT Peptides
3.3.2. CT9 Peptide/CT10/TAT-Cx43 Peptides
3.3.3. TAT-Cx43 266–283 Peptide
3.3.4. JM2 Peptide
4. The Phosphorylation Phenomenon: Cx43-S368-Phosphorylation as a Key Factor in the Effect of Connexin Mimetic Peptides
5. Connexin Peptide Cross-Reactivity with Pannexins
6. Concluding Remarks—Clinical Applications and Future Approaches
Author Contributions
Funding
Acknowledgments
Conflicts of Interest
References
- Revel, J.P.; Karnovsky, M.J. Hexagonal array of subunits in intercellular junctions of the mouse heart and liver. J. Cell Biol. 1967, 33, C7–C12. [Google Scholar] [CrossRef]
- Dewey, M.M.; Barr, L. Intercellular Connection between Smooth Muscle Cells: The Nexus. Science 1962, 137, 670–672. [Google Scholar] [CrossRef]
- Robertson, J.D. The occurence of a subunit pattern in the unit membranes of club endings in mauthner cell synapses in goldfish brains. J. Cell Biol. 1963, 19, 201–221. [Google Scholar] [CrossRef] [Green Version]
- Evans, W.H.; Martin, P.E. Gap junctions: Structure and function (Review). Mol. Membr. Biol. 2002, 19, 121–136. [Google Scholar] [CrossRef]
- Johnstone, S.; Isakson, B.; Locke, D. Biological and biophysical properties of vascular connexin channels. Int. Rev. Cell Mol. Biol. 2009, 278, 69–118. [Google Scholar] [CrossRef] [Green Version]
- Koval, M.; Molina, S.A.; Burt, J.M. Mix and match: Investigating heteromeric and heterotypic gap junction channels in model systems and native tissues. FEBS Lett. 2014, 588, 1193–1204. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Weber, P.A.; Chang, H.C.; Spaeth, K.E.; Nitsche, J.M.; Nicholson, B.J. The permeability of gap junction channels to probes of different size is dependent on connexin composition and permeant-pore affinities. Biophys. J. 2004, 87, 958–973. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Santa Cruz, A.; Meşe, G.; Valiuniene, L.; Brink, P.R.; White, T.W.; Valiunas, V. Altered conductance and permeability of Cx40 mutations associated with atrial fibrillation. J. Gen. Physiol. 2015, 146, 387–398. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kanaporis, G.; Brink, P.R.; Valiunas, V. Gap junction permeability: Selectivity for anionic and cationic probes. Am. J. Physiol. Cell Physiol. 2011, 300, C600–C609. [Google Scholar] [CrossRef] [Green Version]
- Wang, J.; Ma, M.; Locovei, S.; Keane, R.W.; Dahl, G. Modulation of membrane channel currents by gap junction protein mimetic peptides: Size matters. Am. J. Physiol. Cell Physiol. 2007, 293, C1112–C1119. [Google Scholar] [CrossRef] [Green Version]
- Zhu, Y.; Chen, X.; Lu, Y.; Fan, S.; Yang, Y.; Chen, Q.; Huang, Q.; Xia, L.; Wei, Y.; Zheng, J.; et al. Diphenyleneiodonium enhances P2X7 dependent non-opsonized phagocytosis and suppresses inflammasome activation via blocking CX43-mediated ATP leakage. Pharmacol. Res. 2021, 166, 105470. [Google Scholar] [CrossRef] [PubMed]
- Orellana, J.A.; Froger, N.; Ezan, P.; Jiang, J.X.; Bennett, M.V.; Naus, C.C.; Giaume, C.; Sáez, J.C. ATP and glutamate released via astroglial connexin 43 hemichannels mediate neuronal death through activation of pannexin 1 hemichannels. J. Neurochem. 2011, 118, 826–840. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Huckstepp, R.T.; id Bihi, R.; Eason, R.; Spyer, K.M.; Dicke, N.; Willecke, K.; Marina, N.; Gourine, A.V.; Dale, N. Connexin hemichannel-mediated CO2-dependent release of ATP in the medulla oblongata contributes to central respiratory chemosensitivity. J. Physiol. 2010, 588, 3901–3920. [Google Scholar] [CrossRef] [PubMed]
- Turovsky, E.A.; Varlamova, E.G. Mechanism of Ca2+-Dependent Pro-Apoptotic Action of Selenium Nanoparticles, Mediated by Activation of Cx43 Hemichannels. Biology 2021, 10, 743. [Google Scholar] [CrossRef] [PubMed]
- Turovsky, E.A.; Braga, A.; Yu, Y.; Esteras, N.; Korsak, A.; Theparambil, S.M.; Hadjihambi, A.; Hosford, P.S.; Teschemacher, A.G.; Marina, N.; et al. Mechanosensory Signaling in Astrocytes. J. Neurosci. 2020, 40, 9364–9371. [Google Scholar] [CrossRef]
- Turovsky, E.A.; Varlamova, E.G.; Turovskaya, M.V. Activation of Cx43 Hemichannels Induces the Generation of Ca2+ Oscillations in White Adipocytes and Stimulates Lipolysis. Int. J. Mol. Sci. 2021, 22, 8095. [Google Scholar] [CrossRef] [PubMed]
- Pecoraro, M.; Sorrentino, R.; Franceschelli, S.; Del Pizzo, M.; Pinto, A.; Popolo, A. Doxorubicin-Mediated Cardiotoxicity: Role of Mitochondrial Connexin 43. Cardiovasc. Toxicol. 2015, 15, 366–376. [Google Scholar] [CrossRef] [PubMed]
- Fowler, S.L.; Akins, M.; Zhou, H.; Figeys, D.; Bennett, S.A. The liver connexin 32 interactome is a novel plasma membrane-mitochondrial signaling nexus. J. Proteome Res. 2013, 12, 2597–2610. [Google Scholar] [CrossRef]
- Boengler, K.; Bulic, M.; Schreckenberg, R.; Schlüter, K.D.; Schulz, R. The gap junction modifier ZP1609 decreases cardiomyocyte hypercontracture following ischaemia/reperfusion independent from mitochondrial connexin 43. Br. J. Pharmacol. 2017, 174, 2060–2073. [Google Scholar] [CrossRef] [Green Version]
- Johnstone, S.R.; Best, A.K.; Wright, C.S.; Isakson, B.E.; Errington, R.J.; Martin, P.E. Enhanced Connexin 43 Expression Delays Intra-Mitoitc Duration and Cell Cycle Traverse Independently of Gap Junction Channel Function. J. Cell. Biochem. 2010, 110, 772–782. [Google Scholar] [CrossRef] [Green Version]
- Johnstone, S.R.; Kroncke, B.M.; Straub, A.C.; Best, A.K.; Dunn, C.A.; Mitchell, L.A.; Peskova, Y.; Nakamoto, R.K.; Koval, M.; Lo, C.W.; et al. MAPK Phosphorylation of Connexin 43 Promotes Binding of Cyclin E and Smooth Muscle Cell Proliferation. Circ. Res. 2012, 111, U201–U205. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Obert, E.; Strauss, R.; Brandon, C.; Grek, C.; Ghatnekar, G.; Gourdie, R.; Rohrer, B. Targeting the tight junction protein, zonula occludens-1, with the connexin 43 mimetic peptide, alphaCT1, reduces VEGF-dependent RPE pathophysiology. J. Mol. Med. 2017, 95, 535–552. [Google Scholar] [CrossRef] [Green Version]
- Rhett, J.M.; Calder, B.W.; Fann, S.A.; Bainbridge, H.; Gourdie, R.G.; Yost, M.J. Mechanism of action of the anti-inflammatory connexin 43 mimetic peptide JM2. Am. J. Physiol. Cell Physiol. 2017, 313, C314–C326. [Google Scholar] [CrossRef] [Green Version]
- Rhett, J.M.; Ongstad, E.L.; Jourdan, J.; Gourdie, R.G. Cx43 associates with Na(v)1.5 in the cardiomyocyte perinexus. J. Membr. Biol. 2012, 245, 411–422. [Google Scholar] [CrossRef] [Green Version]
- Barker, R.J.; Price, R.L.; Gourdie, R.G. Increased association of ZO-1 with connexin 43 during remodeling of cardiac gap junctions. Circ. Res. 2002, 90, 317–324. [Google Scholar] [CrossRef] [Green Version]
- Calhoun, P.J.; Phan, A.V.; Taylor, J.D.; James, C.C.; Padget, R.L.; Zeitz, M.J.; Smyth, J.W. Adenovirus targets transcriptional and posttranslational mechanisms to limit gap junction function. FASEB J. 2020, 34, 9694–9712. [Google Scholar] [CrossRef]
- James, C.C.; Zeitz, M.J.; Calhoun, P.J.; Lamouille, S.; Smyth, J.W. Altered translation initiation of Gja1 limits gap junction formation during epithelial-mesenchymal transition. Mol. Biol. Cell 2018, 29, 797–808. [Google Scholar] [CrossRef]
- Smyth, J.W.; Zhang, S.S.; Sanchez, J.M.; Lamouille, S.; Vogan, J.M.; Hesketh, G.G.; Hong, T.; Tomaselli, G.F.; Shaw, R.M. A 14-3-3 mode-1 binding motif initiates gap junction internalization during acute cardiac ischemia. Traffic 2014, 15, 684–699. [Google Scholar] [CrossRef] [Green Version]
- Zeitz, M.J.; Calhoun, P.J.; James, C.C.; Taetzsch, T.; George, K.K.; Robel, S.; Valdez, G.; Smyth, J.W. Dynamic UTR Usage Regulates Alternative Translation to Modulate Gap Junction Formation during Stress and Aging. Cell Rep. 2019, 27, 2737–2747.e5. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Smyth, J.W.; Shaw, R.M. Autoregulation of connexin 43 gap junction formation by internally translated isoforms. Cell Rep. 2013, 5, 611–618. [Google Scholar] [CrossRef] [Green Version]
- Epifantseva, I.; Xiao, S.; Baum, R.E.; Kléber, A.G.; Hong, T.; Shaw, R.M. An Alternatively Translated Connexin 43 Isoform, GJA1-11k, Localizes to the Nucleus and Can Inhibit Cell Cycle Progression. Biomolecules 2020, 10, 473. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Johnstone, S.R.; Billaud, M.; Lohman, A.W.; Taddeo, E.P.; Isakson, B.E. Posttranslational Modifications in Connexins and Pannexins. J. Membr. Biol. 2012, 245, 319–332. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Aasen, T.; Johnstone, S.; Vidal-Brime, L.; Lynn, K.S.; Koval, M. Connexins: Synthesis, Post-Translational Modifications, and Trafficking in Health and Disease. Int. J. Mol. Sci. 2018, 19, 1296. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Jacobsen, N.L.; Pontifex, T.K.; Li, H.; Solan, J.L.; Lampe, P.D.; Sorgen, P.L.; Burt, J.M. Regulation of Cx37 channel and growth-suppressive properties by phosphorylation. J. Cell Sci. 2017, 130, 3308–3321. [Google Scholar] [CrossRef] [Green Version]
- Liu, J.; Ek Vitorin, J.F.; Weintraub, S.T.; Gu, S.; Shi, Q.; Burt, J.M.; Jiang, J.X. Phosphorylation of connexin 50 by protein kinase a enhances gap junction and hemichannel function. J. Biol. Chem. 2011, 286, 16914–16928. [Google Scholar] [CrossRef] [Green Version]
- Lampe, P.D.; Cooper, C.D.; King, T.J.; Burt, J.M. Analysis of Connexin 43 phosphorylated at S325, S328 and S330 in normoxic and ischemic heart. J. Cell Sci. 2006, 119, 3435–3442. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Cottrell, G.T.; Lin, R.; Warn-Cramer, B.J.; Lau, A.F.; Burt, J.M. Mechanism of v-Src- and mitogen-activated protein kinase-induced reduction of gap junction communication. Am. J. Physiol. Cell Physiol. 2003, 284, C511–C520. [Google Scholar] [CrossRef]
- Solan, J.L.; Marquez-Rosado, L.; Sorgen, P.L.; Thornton, P.J.; Gafken, P.R.; Lampe, P.D. Phosphorylation at S365 is a gatekeeper event that changes the structure of Cx43 and prevents down-regulation by PKC. J. Cell Biol. 2007, 179, 1301–1309. [Google Scholar] [CrossRef] [Green Version]
- Locke, D.; Bian, S.; Li, H.; Harris, A.L. Post-translational modifications of connexin 26 revealed by mass spectrometry. Biochem. J. 2009, 424, 385–398. [Google Scholar] [CrossRef] [Green Version]
- Bouvier, D.; Kieken, F.; Kellezi, A.; Sorgen, P.L. Structural changes in the carboxyl terminus of the gap junction protein connexin40 caused by the interaction with c-Src and zonula occludens-1. Cell Commun. Adhes. 2008, 15, 107–118. [Google Scholar] [CrossRef] [Green Version]
- Bouvier, D.; Spagnol, G.; Chenavas, S.; Kieken, F.; Vitrac, H.; Brownell, S.; Kellezi, A.; Forge, V.; Sorgen, P.L. Characterization of the structure and intermolecular interactions between the connexin40 and connexin 43 carboxyl-terminal and cytoplasmic loop domains. J. Biol. Chem. 2009, 284, 34257–34271. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Duffy, H.S.; Sorgen, P.L.; Girvin, M.E.; O’Donnell, P.; Coombs, W.; Taffet, S.M.; Delmar, M.; Spray, D.C. pH-dependent intramolecular binding and structure involving Cx43 cytoplasmic domains. J. Biol. Chem. 2002, 277, 36706–36714. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Grosely, R.; Kieken, F.; Sorgen, P.L. 1H, 13C, and 15N backbone resonance assignments of the connexin 43 carboxyl terminal domain attached to the 4th transmembrane domain in detergent micelles. Biomol. NMR Assign. 2013, 7, 299–303. [Google Scholar] [CrossRef] [Green Version]
- Sorgen, P.L.; Duffy, H.S.; Cahill, S.M.; Coombs, W.; Spray, D.C.; Delmar, M.; Girvin, M.E. Sequence-specific resonance assignment of the carboxyl terminal domain of Connexin 43. J. Biomol. NMR 2002, 23, 245–246. [Google Scholar] [CrossRef] [PubMed]
- Sorgen, P.L.; Duffy, H.S.; Spray, D.C.; Delmar, M. pH-dependent dimerization of the carboxyl terminal domain of Cx43. Biophys. J. 2004, 87, 574–581. [Google Scholar] [CrossRef] [Green Version]
- Faniku, C.; O’Shaughnessy, E.; Lorraine, C.; Johnstone, S.R.; Graham, A.; Greenhough, S.; Martin, P.E.M. The Connexin Mimetic Peptide Gap27 and Cx43-Knockdown Reveal Differential Roles for Connexin 43 in Wound Closure Events in Skin Model Systems. Int. J. Mol. Sci. 2018, 19, 604. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Greer, K.; Chen, J.; Brickler, T.; Gourdie, R.; Theus, M.H. Modulation of gap junction-associated Cx43 in neural stem/progenitor cells following traumatic brain injury. Brain Res. Bull. 2017, 134, 38–46. [Google Scholar] [CrossRef]
- Montgomery, J.; Ghatnekar, G.S.; Grek, C.L.; Moyer, K.E.; Gourdie, R.G. Connexin 43-Based Therapeutics for Dermal Wound Healing. Int. J. Mol. Sci. 2018, 19, 1778. [Google Scholar] [CrossRef] [Green Version]
- Palatinus, J.A.; Gourdie, R.G. Diabetes Increases Cryoinjury Size with Associated Effects on Cx43 Gap Junction Function and Phosphorylation in the Mouse Heart. J. Diabetes Res. 2016, 2016, 8789617. [Google Scholar] [CrossRef] [Green Version]
- BEVAN, J.A.; SU, C. The Sympathetic Mechanism in the Isolated Pulmonary Artery of the Rabbit. Br. J. Pharmacol. Chemother. 1964, 22, 176–182. [Google Scholar] [CrossRef] [Green Version]
- Dhein, S.; Larsen, B.D.; Petersen, J.S.; Mohr, F.W. Effects of the new antiarrhythmic peptide ZP123 on epicardial activation and repolarization pattern. Cell Commun. Adhes. 2003, 10, 371–378. [Google Scholar] [CrossRef]
- Engstrøm, T.; Nepper-Christensen, L.; Helqvist, S.; Kløvgaard, L.; Holmvang, L.; Jørgensen, E.; Pedersen, F.; Saunamaki, K.; Tilsted, H.H.; Steensberg, A.; et al. Danegaptide for primary percutaneous coronary intervention in acute myocardial infarction patients: A phase 2 randomised clinical trial. Heart 2018, 104, 1593–1599. [Google Scholar] [CrossRef] [Green Version]
- Grek, C.L.; Montgomery, J.; Sharma, M.; Ravi, A.; Rajkumar, J.S.; Moyer, K.E.; Gourdie, R.G.; Ghatnekar, G.S. A Multicenter Randomized Controlled Trial Evaluating a Cx43-Mimetic Peptide in Cutaneous Scarring. J. Invest. Dermatol. 2017, 137, 620–630. [Google Scholar] [CrossRef] [Green Version]
- Evans, W.H.; Leybaert, L. Mimetic peptides as blockers of connexin channel-facilitated intercellular communication. Cell Commun. Adhes. 2007, 14, 265–273. [Google Scholar] [CrossRef]
- Leybaert, L.; Lampe, P.D.; Dhein, S.; Kwak, B.R.; Ferdinandy, P.; Beyer, E.C.; Laird, D.W.; Naus, C.C.; Green, C.R.; Schulz, R. Connexins in Cardiovascular and Neurovascular Health and Disease: Pharmacological Implications. Pharmacol. Rev. 2017, 69, 396–478. [Google Scholar] [CrossRef]
- Schulz, R.; Görge, P.M.; Görbe, A.; Ferdinandy, P.; Lampe, P.D.; Leybaert, L. Connexin 43 is an emerging therapeutic target in ischemia/reperfusion injury, cardioprotection and neuroprotection. Pharmacol. Ther. 2015, 153, 90–106. [Google Scholar] [CrossRef] [Green Version]
- Giaume, C.; Leybaert, L.; Naus, C.C.; Saez, J.C. Connexin and pannexin hemichannels in brain glial cells: Properties, pharmacology, and roles. Front. Pharmacol. 2013, 4, 88. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- De Vuyst, E.; Boengler, K.; Antoons, G.; Sipido, K.R.; Schulz, R.; Leybaert, L. Pharmacological modulation of connexin-formed channels in cardiac pathophysiology. Br. J. Pharmacol. 2011, 163, 469–483. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Marsh, S.R.; Williams, Z.J.; Pridham, K.J.; Gourdie, R.G. Peptidic Connexin 43 Therapeutics in Cardiac Reparative Medicine. J. Cardiovasc Dev. Dis. 2021, 8, 52. [Google Scholar] [CrossRef]
- Green, C.R.; Severs, N.J. Gap junction connexon configuration in rapidly frozen myocardium and isolated intercalated disks. J. Cell Biol. 1984, 99, 453–463. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Dunn, C.A.; Lampe, P.D. Injury-triggered Akt phosphorylation of Cx43: A ZO-1-driven molecular switch that regulates gap junction size. J. Cell Sci. 2014, 127, 455–464. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Jeyaraman, M.M.; Srisakuldee, W.; Nickel, B.E.; Kardami, E. Connexin 43 phosphorylation and cytoprotection in the heart. Biochim. Biophys. Acta 2012, 1818, 2009–2013. [Google Scholar] [CrossRef] [Green Version]
- George, S.A.; Hoeker, G.; Calhoun, P.J.; Entz, M., 2nd; Raisch, T.B.; King, D.R.; Khan, M.; Baker, C.; Gourdie, R.G.; Smyth, J.W.; et al. Modulating cardiac conduction during metabolic ischemia with perfusate sodium and calcium in guinea pig hearts. Am. J. Physiol. Heart Circ. Physiol. 2019, 316, H849–H861. [Google Scholar] [CrossRef] [PubMed]
- Aonuma, S.; Kohama, Y.; Akai, K.; Komiyama, Y.; Nakajima, S.; Wakabayashi, M.; Makino, T. Studies on heart. XIX. Isolation of an atrial peptide that improves the rhythmicity of cultured myocardial cell clusters. Chem. Pharm. Bull. 1980, 28, 3332–3339. [Google Scholar] [CrossRef] [Green Version]
- Jozwiak, J.; Dhein, S. Local effects and mechanisms of antiarrhythmic peptide AAP10 in acute regional myocardial ischemia: Electrophysiological and molecular findings. Naunyn Schmiedebergs Arch Pharmacol. 2008, 378, 459–470. [Google Scholar] [CrossRef] [PubMed]
- Quan, X.Q.; Bai, R.; Liu, N.; Chen, B.D.; Zhang, C.T. Increasing gap junction coupling reduces transmural dispersion of repolarization and prevents torsade de pointes in rabbit LQT3 model. J. Cardiovasc. Electrophysiol. 2007, 18, 1184–1189. [Google Scholar] [CrossRef]
- Quan, X.Q.; Bai, R.; Lu, J.G.; Patel, C.; Liu, N.; Ruan, Y.; Chen, B.D.; Ruan, L.; Zhang, C.T. Pharmacological enhancement of cardiac gap junction coupling prevents arrhythmias in canine LQT2 model. Cell Commun. Adhes. 2009, 16, 29–38. [Google Scholar] [CrossRef]
- Axelsen, L.N.; Stahlhut, M.; Mohammed, S.; Larsen, B.D.; Nielsen, M.S.; Holstein-Rathlou, N.H.; Andersen, S.; Jensen, O.N.; Hennan, J.K.; Kjolbye, A.L. Identification of ischemia-regulated phosphorylation sites in connexin 43: A possible target for the antiarrhythmic peptide analogue rotigaptide (ZP123). J. Mol. Cell. Cardiol. 2006, 40, 790–798. [Google Scholar] [CrossRef]
- Skyschally, A.; Walter, B.; Schultz Hansen, R.; Heusch, G. The antiarrhythmic dipeptide ZP1609 (danegaptide) when given at reperfusion reduces myocardial infarct size in pigs. Naunyn Schmiedebergs Arch Pharmacol. 2013, 386, 383–391. [Google Scholar] [CrossRef]
- Hennan, J.K.; Swillo, R.E.; Morgan, G.A.; Keith, J.C.; Schaub, R.G.; Smith, R.P.; Feldman, H.S.; Haugan, K.; Kantrowitz, J.; Wang, P.J.; et al. Rotigaptide (ZP123) prevents spontaneous ventricular arrhythmias and reduces infarct size during myocardial ischemia/reperfusion injury in open-chest dogs. J. Pharmacol. Exp. Ther. 2006, 317, 236–243. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Johnstone, S.R.; Isakson, B.E. ‘Gaps’ in targeted ischaemic injury therapies in ST-elevation myocardial infarction. Heart 2018, 104, 1557–1558. [Google Scholar] [CrossRef] [PubMed]
- Easton, J.A.; Petersen, J.S.; Martin, P.E. The anti-arrhythmic peptide AAP10 remodels Cx43 and Cx40 expression and function. Naunyn Schmiedebergs Arch. Pharmacol. 2009, 380, 11–24. [Google Scholar] [CrossRef]
- Clarke, T.C.; Williams, O.J.; Martin, P.E.; Evans, W.H. ATP release by cardiac myocytes in a simulated ischaemia model: Inhibition by a connexin mimetic and enhancement by an antiarrhythmic peptide. Eur. J. Pharmacol. 2009, 605, 9–14. [Google Scholar] [CrossRef] [PubMed]
- Patin, J.; Castro, C.; Steenman, M.; Hivonnait, A.; Carcouët, A.; Tessier, A.; Lebreton, J.; Bihouée, A.; Donnart, A.; Le Marec, H.; et al. Gap-134, a Connexin 43 activator, prevents age-related development of ventricular fibrosis in Scn5a. Pharmacol. Res. 2020, 159, 104922. [Google Scholar] [CrossRef] [PubMed]
- Squires, P.E.; Price, G.W.; Mouritzen, U.; Potter, J.A.; Williams, B.M.; Hills, C.E. Danegaptide Prevents TGFβ1-Induced Damage in Human Proximal Tubule Epithelial Cells of the Kidney. Int. J. Mol. Sci. 2021, 22, 2809. [Google Scholar] [CrossRef]
- Weng, S.; Lauven, M.; Schaefer, T.; Polontchouk, L.; Grover, R.; Dhein, S. Pharmacological modification of gap junction coupling by an antiarrhythmic peptide via protein kinase C activation. FASEB J. 2002, 16, 1114–1116. [Google Scholar] [CrossRef]
- Dhein, S.; Weng, S.; Grover, R.; Tudyka, T.; Gottwald, M.; Schaefer, T.; Polontchouk, L. Protein kinase Calpha mediates the effect of antiarrhythmic peptide on gap junction conductance. Cell Commun. Adhes. 2001, 8, 257–264. [Google Scholar] [CrossRef] [Green Version]
- Stahlhut, M.; Petersen, J.S.; Hennan, J.K.; Ramirez, M.T. The antiarrhythmic peptide rotigaptide (ZP123) increases connexin 43 protein expression in neonatal rat ventricular cardiomyocytes. Cell Commun. Adhes. 2006, 13, 21–27. [Google Scholar] [CrossRef] [Green Version]
- Haugan, K.; Kjølbye, A.L.; Hennan, J.K.; Petersen, J.S. Rotigaptide (ZP123) reverts established atrial conduction velocity slowing. Cell Commun. Adhes. 2005, 12, 271–278. [Google Scholar] [CrossRef] [PubMed]
- Xue, J.; Yan, X.; Yang, Y.; Chen, M.; Wu, L.; Gou, Z.; Sun, Z.; Talabieke, S.; Zheng, Y.; Luo, D. Connexin 43 dephosphorylation contributes to arrhythmias and cardiomyocyte apoptosis in ischemia/reperfusion hearts. Basic Res. Cardiol. 2019, 114, 40. [Google Scholar] [CrossRef] [PubMed]
- Alstrom, J.S.; Stroemlund, L.W.; Nielsen, M.S.; MacAulay, N. Protein kinase C-dependent regulation of connexin 43 gap junctions and hemichannels. Biochem. Soc. Trans. 2015, 43, 519–523. [Google Scholar] [CrossRef]
- Doble, B.W.; Dang, X.; Ping, P.; Fandrich, R.R.; Nickel, B.E.; Jin, Y.; Cattini, P.A.; Kardami, E. Phosphorylation of serine 262 in the gap junction protein connexin-43 regulates DNA synthesis in cell-cell contact forming cardiomyocytes. J. Cell Sci. 2004, 117, 507–514. [Google Scholar] [CrossRef] [Green Version]
- Doble, B.W.; Ping, P.; Kardami, E. The epsilon subtype of protein kinase C is required for cardiomyocyte connexin-43 phosphorylation. Circ. Res. 2000, 86, 293–301. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Grover, R.; Dhein, S. Structure-activity relationships of novel peptides related to the antiarrhythmic peptide AAP10 which reduce the dispersion of epicardial action potential duration. Peptides 2001, 22, 1011–1021. [Google Scholar] [CrossRef]
- Aasen, T.; Mesnil, M.; Naus, C.C.; Lampe, P.D.; Laird, D.W. Gap junctions and cancer: Communicating for 50 years. Nat. Rev. Cancer 2017, 17, 74. [Google Scholar] [CrossRef]
- Kim, D.; Mouritzen, U.; Larsen, B.D.; Roy, S. Inhibition of Cx43 gap junction uncoupling prevents high glucose-induced apoptosis and reduces excess cell monolayer permeability in retinal vascular endothelial cells. Exp. Eye Res. 2018, 173, 85–90. [Google Scholar] [CrossRef] [PubMed]
- Freitas-Andrade, M.; Bechberger, J.; Wang, J.; Yeung, K.K.C.; Whitehead, S.N.; Hansen, R.S.; Naus, C.C. Danegaptide Enhances Astrocyte Gap Junctional Coupling and Reduces Ischemic Reperfusion Brain Injury in Mice. Biomolecules 2020, 10, 353. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- DeLalio, L.J.; Isakson, B.E. ZP1609/danegaptide and mitochondrial connexin hemichannels: A harbinger for peptide drug design. Br. J. Pharmacol. 2017, 174, 2606–2607. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yu, J.; Lin, Y.H.; Yang, L.; Huang, C.C.; Chen, L.; Wang, W.C.; Chen, G.W.; Yan, J.; Sawettanun, S.; Lin, C.H. Improved Anticancer Photothermal Therapy Using the Bystander Effect Enhanced by Antiarrhythmic Peptide Conjugated Dopamine-Modified Reduced Graphene Oxide Nanocomposite. Adv. Healthc Mater. 2017, 6. [Google Scholar] [CrossRef]
- Yang, W.; Lampe, P.D.; Kensel-Hammes, P.; Hesson, J.; Ware, C.B.; Crisa, L.; Cirulli, V. Connexin 43 Functions as a Positive Regulator of Stem Cell Differentiation into Definitive Endoderm and Pancreatic Progenitors. iScience 2019, 19, 450–460. [Google Scholar] [CrossRef] [Green Version]
- Chen, K.; Chen, L.; Ouyang, Y.; Zhang, L.; Li, X.; Li, L.; Si, J.; Wang, L.; Ma, K. Pirfenidone attenuates homocysteine-induced apoptosis by regulating the connexin 43 pathway in H9C2 cells. Int. J. Mol. Med. 2020, 45, 1081–1090. [Google Scholar] [CrossRef] [PubMed]
- Chaytor, A.T.; Evans, W.H.; Griffith, T.M. Peptides homologous to extracellular loop motifs of connexin 43 reversibly abolish rhythmic contractile activity in rabbit arteries. J. Physiol. 1997, 503 Pt 1, 99–110. [Google Scholar] [CrossRef]
- Chaytor, A.T.; Martin, P.E.; Evans, W.H.; Randall, M.D.; Griffith, T.M. The endothelial component of cannabinoid-induced relaxation in rabbit mesenteric artery depends on gap junctional communication. J. Physiol. 1999, 520 Pt 2, 539–550. [Google Scholar] [CrossRef]
- Chaytor, A.T.; Martin, P.E.; Edwards, D.H.; Griffith, T.M. Gap junctional communication underpins EDHF-type relaxations evoked by ACh in the rat hepatic artery. Am. J. Physiol. Heart Circ. Physiol. 2001, 280, H2441–H2450. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ju, H.; Wang, Y.; Shi, Q.; Zhou, Y.; Ma, R.; Wu, P.; Fang, H. Inhibition of connexin 43 hemichannels improves postoperative cognitive function in aged mice. Am. J. Transl. Res. 2019, 11, 2280–2287. [Google Scholar]
- Wright, C.S.; van Steensel, M.A.; Hodgins, M.B.; Martin, P.E. Connexin mimetic peptides improve cell migration rates of human epidermal keratinocytes and dermal fibroblasts in vitro. Wound Repair Regen. 2009, 17, 240–249. [Google Scholar] [CrossRef]
- Eugenín, E.A.; González, H.; Sáez, C.G.; Sáez, J.C. Gap junctional communication coordinates vasopressin-induced glycogenolysis in rat hepatocytes. Am. J. Physiol. 1998, 274, G1109–G1116. [Google Scholar] [CrossRef] [PubMed]
- Mendoza-Naranjo, A.; Saéz, P.J.; Johansson, C.C.; Ramírez, M.; Mandakovic, D.; Pereda, C.; López, M.N.; Kiessling, R.; Sáez, J.C.; Salazar-Onfray, F. Functional gap junctions facilitate melanoma antigen transfer and cross-presentation between human dendritic cells. J. Immunol. 2007, 178, 6949–6957. [Google Scholar] [CrossRef] [Green Version]
- Kwak, B.R.; Jongsma, H.J. Selective inhibition of gap junction channel activity by synthetic peptides. J. Physiol. 1999, 516 Pt 3, 679–685. [Google Scholar] [CrossRef]
- Martin, P.E.; Wall, C.; Griffith, T.M. Effects of connexin-mimetic peptides on gap junction functionality and connexin expression in cultured vascular cells. Br. J. Pharmacol. 2005, 144, 617–627. [Google Scholar] [CrossRef] [Green Version]
- De Bock, M.; Wang, N.; Bol, M.; Decrock, E.; Ponsaerts, R.; Bultynck, G.; Dupont, G.; Leybaert, L. Connexin 43 hemichannels contribute to cytoplasmic Ca2+ oscillations by providing a bimodal Ca2+-dependent Ca2+ entry pathway. J. Biol. Chem. 2012, 287, 12250–12266. [Google Scholar] [CrossRef] [Green Version]
- Sahli, K.A.; Flora, G.D.; Sasikumar, P.; Maghrabi, A.H.; Holbrook, L.M.; AlOuda, S.K.; Elgheznawy, A.; Sage, T.; Stainer, A.R.; Adiyaman, R.; et al. Structural, functional, and mechanistic insights uncover the fundamental role of orphan connexin-62 in platelets. Blood 2021, 137, 830–843. [Google Scholar] [CrossRef] [PubMed]
- O’Carroll, S.J.; Alkadhi, M.; Nicholson, L.F.; Green, C.R. Connexin 43 mimetic peptides reduce swelling, astrogliosis, and neuronal cell death after spinal cord injury. Cell Commun. Adhes. 2008, 15, 27–42. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Danesh-Meyer, H.V.; Kerr, N.M.; Zhang, J.; Eady, E.K.; O’Carroll, S.J.; Nicholson, L.F.; Johnson, C.S.; Green, C.R. Connexin 43 mimetic peptide reduces vascular leak and retinal ganglion cell death following retinal ischaemia. Brain 2012, 135, 506–520. [Google Scholar] [CrossRef] [Green Version]
- Mao, Y.; Nguyen, T.; Tonkin, R.S.; Lees, J.G.; Warren, C.; O’Carroll, S.J.; Nicholson, L.F.B.; Green, C.R.; Moalem-Taylor, G.; Gorrie, C.A. Characterisation of Peptide5 systemic administration for treating traumatic spinal cord injured rats. Exp. Brain Res. 2017, 235, 3033–3048. [Google Scholar] [CrossRef]
- Mao, Y.; Tonkin, R.S.; Nguyen, T.; O’Carroll, S.J.; Nicholson, L.F.; Green, C.R.; Moalem-Taylor, G.; Gorrie, C.A. Systemic Administration of Connexin 43 Mimetic Peptide Improves Functional Recovery after Traumatic Spinal Cord Injury in Adult Rats. J. Neurotrauma 2017, 34, 707–719. [Google Scholar] [CrossRef]
- Cotter, M.L.; Boitano, S.; Lampe, P.D.; Solan, J.L.; Vagner, J.; Ek-Vitorin, J.F.; Burt, J.M. The lipidated connexin mimetic peptide SRPTEKT-. Am. J. Physiol. Cell Physiol. 2019, 317, C825–C842. [Google Scholar] [CrossRef] [PubMed]
- Cotter, M.L.; Boitano, S.; Vagner, J.; Burt, J.M. Lipidated connexin mimetic peptides potently inhibit gap junction-mediated Ca. Am. J. Physiol. Cell Physiol. 2018, 315, C141–C154. [Google Scholar] [CrossRef] [PubMed]
- Chen, Y.S.; Toth, I.; Danesh-Meyer, H.V.; Green, C.R.; Rupenthal, I.D. Cytotoxicity and vitreous stability of chemically modified connexin 43 mimetic peptides for the treatment of optic neuropathy. J. Pharm. Sci. 2013, 102, 2322–2331. [Google Scholar] [CrossRef] [PubMed]
- De Vuyst, E.; Decrock, E.; Cabooter, L.; Dubyak, G.R.; Naus, C.C.; Evans, W.H.; Leybaert, L. Intracellular calcium changes trigger connexin 32 hemichannel opening. EMBO J. 2006, 25, 34–44. [Google Scholar] [CrossRef] [Green Version]
- Maes, M.; Crespo Yanguas, S.; Willebrords, J.; Weemhoff, J.L.; da Silva, T.C.; Decrock, E.; Lebofsky, M.; Pereira, I.V.A.; Leybaert, L.; Farhood, A.; et al. Connexin hemichannel inhibition reduces acetaminophen-induced liver injury in mice. Toxicol Lett. 2017, 278, 30–37. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Seki, A.; Duffy, H.S.; Coombs, W.; Spray, D.C.; Taffet, S.M.; Delmar, M. Modifications in the biophysical properties of connexin 43 channels by a peptide of the cytoplasmic loop region. Circ. Res. 2004, 95, e22–e28. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Seki, A.; Coombs, W.; Taffet, S.M.; Delmar, M. Loss of electrical communication, but not plaque formation, after mutations in the cytoplasmic loop of connexin 43. Heart Rhythm 2004, 1, 227–233. [Google Scholar] [CrossRef]
- Ponsaerts, R.; De Vuyst, E.; Retamal, M.; D’Hondt, C.; Vermeire, D.; Wang, N.; De Smedt, H.; Zimmermann, P.; Himpens, B.; Vereecke, J.; et al. Intramolecular loop/tail interactions are essential for connexin 43-hemichannel activity. FASEB J. 2010, 24, 4378–4395. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Wang, N.; De Vuyst, E.; Ponsaerts, R.; Boengler, K.; Palacios-Prado, N.; Wauman, J.; Lai, C.P.; De Bock, M.; Decrock, E.; Bol, M.; et al. Selective inhibition of Cx43 hemichannels by Gap19 and its impact on myocardial ischemia/reperfusion injury. Basic Res. Cardiol. 2013, 108, 309. [Google Scholar] [CrossRef] [Green Version]
- Becker, D.L.; Evans, W.H.; Green, C.R.; Warner, A. Functional analysis of amino acid sequences in connexin 43 involved in intercellular communication through gap junctions. J. Cell Sci. 1995, 108 Pt 4, 1455–1467. [Google Scholar] [CrossRef]
- Abudara, V.; Bechberger, J.; Freitas-Andrade, M.; De Bock, M.; Wang, N.; Bultynck, G.; Naus, C.C.; Leybaert, L.; Giaume, C. The connexin 43 mimetic peptide Gap19 inhibits hemichannels without altering gap junctional communication in astrocytes. Front. Cell Neurosci. 2014, 8, 306. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Coutinho, F.P.; Green, C.R.; Acosta, M.L.; Rupenthal, I.D. Xentry-Gap19 inhibits Connexin 43 hemichannel opening especially during hypoxic injury. Drug Deliv. Transl. Res. 2020, 10, 751–765. [Google Scholar] [CrossRef] [PubMed]
- Earley, S.; Resta, T.C.; Walker, B.R. Disruption of smooth muscle gap junctions attenuates myogenic vasoconstriction of mesenteric resistance arteries. Am. J. Physiol. Heart Circ. Physiol. 2004, 287, H2677–H2686. [Google Scholar] [CrossRef] [Green Version]
- Palatinus, J.A.; Rhett, J.M.; Gourdie, R.G. Enhanced PKCepsilon mediated phosphorylation of connexin 43 at serine 368 by a carboxyl-terminal mimetic peptide is dependent on injury. Channels 2011, 5, 236–240. [Google Scholar] [CrossRef] [Green Version]
- Hunter, A.W.; Barker, R.J.; Zhu, C.; Gourdie, R.G. Zonula occludens-1 alters connexin 43 gap junction size and organization by influencing channel accretion. Mol. Biol. Cell 2005, 16, 5686–5698. [Google Scholar] [CrossRef] [Green Version]
- Ghatnekar, G.S.; O’Quinn, M.P.; Jourdan, L.J.; Gurjarpadhye, A.A.; Draughn, R.L.; Gourdie, R.G. Connexin 43 carboxyl-terminal peptides reduce scar progenitor and promote regenerative healing following skin wounding. Regen. Med. 2009, 4, 205–223. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Jiang, J.; Hoagland, D.; Palatinus, J.A.; He, H.; Iyyathurai, J.; Jourdan, L.J.; Bultynck, G.; Wang, Z.; Zhang, Z.; Schey, K.; et al. Interaction of alpha Carboxyl Terminus 1 Peptide with the Connexin 43 Carboxyl Terminus Preserves Left Ventricular Function After Ischemia-Reperfusion Injury. J. Am. Heart Assoc. 2019, 8, e012385. [Google Scholar] [CrossRef] [PubMed]
- Bond, S.R.; Wang, N.; Leybaert, L.; Naus, C.C. Pannexin 1 ohnologs in the teleost lineage. J. Membr. Biol. 2012, 245, 483–493. [Google Scholar] [CrossRef]
- O’Quinn, M.P.; Palatinus, J.A.; Harris, B.S.; Hewett, K.W.; Gourdie, R.G. A peptide mimetic of the connexin 43 carboxyl terminus reduces gap junction remodeling and induced arrhythmia following ventricular injury. Circ. Res. 2011, 108, 704–715. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Verma, V.; Larsen, B.D.; Coombs, W.; Lin, X.; Sarrou, E.; Taffet, S.M.; Delmar, M. Design and characterization of the first peptidomimetic molecule that prevents acidification-induced closure of cardiac gap junctions. Heart Rhythm 2010, 7, 1491–1498. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Calder, B.W.; Matthew Rhett, J.; Bainbridge, H.; Fann, S.A.; Gourdie, R.G.; Yost, M.J. Inhibition of connexin 43 hemichannel-mediated ATP release attenuates early inflammation during the foreign body response. Tissue Eng. Part. A 2015, 21, 1752–1762. [Google Scholar] [CrossRef] [Green Version]
- Pelaz, S.G.; Jaraíz-Rodríguez, M.; Álvarez-Vázquez, A.; Talaverón, R.; García-Vicente, L.; Flores-Hernández, R.; Gómez de Cedrón, M.; Tabernero, M.; Ramírez de Molina, A.; Lillo, C.; et al. Targeting metabolic plasticity in glioma stem cells in vitro and in vivo through specific inhibition of c-Src by TAT-Cx43. EBioMedicine 2020, 62, 103134. [Google Scholar] [CrossRef] [PubMed]
- Talaveron, R.; Matarredona, E.R.; Herrera, A.; Medina, J.M.; Tabernero, A. Connexin 43 Region 266–283, via Src Inhibition, Reduces Neural Progenitor Cell Proliferation Promoted by EGF and FGF-2 and Increases Astrocytic Differentiation. Int. J. Mol. Sci. 2020, 21, 8852. [Google Scholar] [CrossRef]
- Meyer, R.A.; Laird, D.W.; Revel, J.P.; Johnson, R.G. Inhibition of gap junction and adherens junction assembly by connexin and A-CAM antibodies. J. Cell Biol. 1992, 119, 179–189. [Google Scholar] [CrossRef] [Green Version]
- Goodenough, D.A.; Paul, D.L.; Jesaitis, L. Topological distribution of two connexin 32 antigenic sites in intact and split rodent hepatocyte gap junctions. J. Cell Biol. 1988, 107, 1817–1824. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Dahl, G.; Nonner, W.; Werner, R. Attempts to define functional domains of gap junction proteins with synthetic peptides. Biophys. J. 1994, 67, 1816–1822. [Google Scholar] [CrossRef] [Green Version]
- Evans, W.H.; Boitano, S. Connexin mimetic peptides: Specific inhibitors of gap-junctional intercellular communication. Biochem.Soc. Trans. 2001, 29, 606–612. [Google Scholar] [CrossRef] [Green Version]
- Warner, A.; Clements, D.K.; Parikh, S.; Evans, W.H.; DeHaan, R.L. Specific motifs in the external loops of connexin proteins can determine gap junction formation between chick heart myocytes. J. Physiol. 1995, 488 Pt 3, 721–728. [Google Scholar] [CrossRef] [PubMed]
- Glass, B.J.; Hu, R.G.; Phillips, A.R.; Becker, D.L. The action of mimetic peptides on connexins protects fibroblasts from the negative effects of ischemia reperfusion. Biol. Open 2015, 4, 1473–1480. [Google Scholar] [CrossRef] [Green Version]
- Desplantez, T.; Verma, V.; Leybaert, L.; Evans, W.H.; Weingart, R. Gap26, a connexin mimetic peptide, inhibits currents carried by connexin 43 hemichannels and gap junction channels. Pharmacol. Res. 2012, 65, 546–552. [Google Scholar] [CrossRef]
- Davidson, J.O.; Green, C.R.; Nicholson, L.F.; O’Carroll, S.J.; Fraser, M.; Bennet, L.; Gunn, A.J. Connexin hemichannel blockade improves outcomes in a model of fetal ischemia. Ann. Neurol. 2012, 71, 121–132. [Google Scholar] [CrossRef]
- Wang, N.; De Bock, M.; Decrock, E.; Bol, M.; Gadicherla, A.; Bultynck, G.; Leybaert, L. Connexin targeting peptides as inhibitors of voltage- and intracellular Ca2+-triggered Cx43 hemichannel opening. Neuropharmacology 2013, 75, 506–516. [Google Scholar] [CrossRef]
- Berman, R.S.; Martin, P.E.; Evans, W.H.; Griffith, T.M. Relative contributions of NO and gap junctional communication to endothelium-dependent relaxations of rabbit resistance arteries vary with vessel size. Microvasc Res. 2002, 63, 115–128. [Google Scholar] [CrossRef]
- Elbadawy, H.M.; Mirabelli, P.; Xeroudaki, M.; Parekh, M.; Bertolin, M.; Breda, C.; Cagini, C.; Ponzin, D.; Lagali, N.; Ferrari, S. Effect of connexin 43 inhibition by the mimetic peptide Gap27 on corneal wound healing, inflammation and neovascularization. Br. J. Pharmacol. 2016, 173, 2880–2893. [Google Scholar] [CrossRef]
- Wright, C.S.; Pollok, S.; Flint, D.J.; Brandner, J.M.; Martin, P.E. The connexin mimetic peptide Gap27 increases human dermal fibroblast migration in hyperglycemic and hyperinsulinemic conditions in vitro. J. Cell Physiol. 2012, 227, 77–87. [Google Scholar] [CrossRef] [PubMed]
- Hawat, G.; Hélie, P.; Baroudi, G. Single intravenous low-dose injections of connexin 43 mimetic peptides protect ischemic heart in vivo against myocardial infarction. J. Mol. Cell. Cardiol. 2012, 53, 559–566. [Google Scholar] [CrossRef] [PubMed]
- Sorensen, C.M.; Salomonsson, M.; Braunstein, T.H.; Nielsen, M.S.; Holstein-Rathlou, N.H. Connexin mimetic peptides fail to inhibit vascular conducted calcium responses in renal arterioles. Am. J. Physiol. Regul Integr. Comp. Physiol. 2008, 295, R840–R847. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Matchkov, V.V.; Rahman, A.; Bakker, L.M.; Griffith, T.M.; Nilsson, H.; Aalkjaer, C. Analysis of effects of connexin-mimetic peptides in rat mesenteric small arteries. Am. J. Physiol. Heart Circ. Physiol. 2006, 291, H357–H367. [Google Scholar] [CrossRef] [PubMed]
- Solan, J.L.; Lampe, P.D. Connexin phosphorylation as a regulatory event linked to gap junction channel assembly. Biochim. Biophys. Acta 2005, 1711, 154–163. [Google Scholar] [CrossRef] [Green Version]
- Solan, J.L.; Lampe, P.D. Connexin 43 phosphorylation: Structural changes and biological effects. Biochem. J. 2009, 419, 261–272. [Google Scholar] [CrossRef] [Green Version]
- Simon, A.; Magyar, C.; Heja, L.; Kardon, J. Peptide binding sites of connexin proteins. Chemistry 2020, 2, 662–673. [Google Scholar] [CrossRef]
- Neijssen, J.; Herberts, C.; Drijfhout, J.W.; Reits, E.; Janssen, L.; Neefjes, J. Cross-presentation by intercellular peptide transfer through gap junctions. Nature 2005, 434, 83–88. [Google Scholar] [CrossRef] [PubMed]
- Morley, G.E.; Taffet, S.M.; Delmar, M. Intramolecular interactions mediate pH regulation of connexin 43 channels. Biophys. J. 1996, 70, 1294–1302. [Google Scholar] [CrossRef] [Green Version]
- Liu, S.; Taffet, S.; Stoner, L.; Delmar, M.; Vallano, M.L.; Jalife, J. A structural basis for the unequal sensitivity of the major cardiac and liver gap junctions to intracellular acidification: The carboxyl tail length. Biophys. J. 1993, 64, 1422–1433. [Google Scholar] [CrossRef] [Green Version]
- Moreno, A.P.; Chanson, M.; Elenes, S.; Anumonwo, J.; Scerri, I.; Gu, H.; Taffet, S.M.; Delmar, M. Role of the carboxyl terminal of connexin 43 in transjunctional fast voltage gating. Circ. Res. 2002, 90, 450–457. [Google Scholar] [CrossRef] [PubMed]
- Anumonwo, J.M.; Taffet, S.M.; Gu, H.; Chanson, M.; Moreno, A.P.; Delmar, M. The carboxyl terminal domain regulates the unitary conductance and voltage dependence of connexin40 gap junction channels. Circ. Res. 2001, 88, 666–673. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- D’hondt, C.; Iyyathurai, J.; Wang, N.; Gourdie, R.G.; Himpens, B.; Leybaert, L.; Bultynck, G. Negatively charged residues (Asp378 and Asp379) in the last ten amino acids of the C-terminal tail of Cx43 hemichannels are essential for loop/tail interactions. Biochem. Biophys. Res. Commun. 2013, 432, 707–712. [Google Scholar] [CrossRef] [PubMed]
- Delmar, M.; Coombs, W.; Sorgen, P.; Duffy, H.S.; Taffet, S.M. Structural bases for the chemical regulation of Connexin 43 channels. Cardiovasc. Res. 2004, 62, 268–275. [Google Scholar] [CrossRef] [Green Version]
- Gump, J.M.; Dowdy, S.F. TAT transduction: The molecular mechanism and therapeutic prospects. Trends Mol. Med. 2007, 13, 443–448. [Google Scholar] [CrossRef]
- Lindgren, M.; Hällbrink, M.; Prochiantz, A.; Langel, U. Cell-penetrating peptides. Trends Pharmacol. Sci. 2000, 21, 99–103. [Google Scholar] [CrossRef]
- Carrigan, C.N.; Imperiali, B. The engineering of membrane-permeable peptides. Anal. Biochem. 2005, 341, 290–298. [Google Scholar] [CrossRef]
- Yu, H.; Cao, X.; Li, W.; Liu, P.; Zhao, Y.; Song, L.; Chen, J.; Chen, B.; Yu, W.; Xu, Y. Targeting connexin 43 provides anti-inflammatory effects after intracerebral hemorrhage injury by regulating YAP signaling. J. Neuroinflamm. 2020, 17, 322. [Google Scholar] [CrossRef]
- De Smet, M.A.; Lissoni, A.; Nezlobinsky, T.; Wang, N.; Dries, E.; Pérez-Hernández, M.; Lin, X.; Amoni, M.; Vervliet, T.; Witschas, K.; et al. Cx43 hemichannel microdomain signaling at the intercalated disc enhances cardiac excitability. J. Clin. Invest. 2021, 131. [Google Scholar] [CrossRef]
- Deschenes, S.M.; Walcott, J.L.; Wexler, T.L.; Scherer, S.S.; Fischbeck, K.H. Altered trafficking of mutant connexin 32. J. Neurosci. 1997, 17, 9077–9084. [Google Scholar] [CrossRef]
- Ressot, C.; Gomes, D.; Dautigny, A.; Pham-Dinh, D.; Bruzzone, R. Connexin 32 mutations associated with X-linked Charcot-Marie-Tooth disease show two distinct behaviors: Loss of function and altered gating properties. J. Neurosci. 1998, 18, 4063–4075. [Google Scholar] [CrossRef] [PubMed]
- Leithe, E.; Mesnil, M.; Aasen, T. The connexin 43 C-terminus: A tail of many tales. Biochim. Biophys. Acta Biomembr. 2018, 1860, 48–64. [Google Scholar] [CrossRef] [PubMed]
- Rhett, J.M.; Jourdan, J.; Gourdie, R.G. Connexin 43 connexon to gap junction transition is regulated by zonula occludens-1. Mol. Biol. Cell 2011, 22, 1516–1528. [Google Scholar] [CrossRef] [PubMed]
- Thevenin, A.F.; Margraf, R.A.; Fisher, C.G.; Kells-Andrews, R.M.; Falk, M.M. Phosphorylation regulates connexin 43/ZO-1 binding and release, an important step in gap junction turnover. Mol. Biol. Cell 2017, 28, 3595–3608. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lauf, U.; Giepmans, B.N.; Lopez, P.; Braconnot, S.; Chen, S.C.; Falk, M.M. Dynamic trafficking and delivery of connexons to the plasma membrane and accretion to gap junctions in living cells. Proc. Natl. Acad. Sci. USA 2002, 99, 10446–10451. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Grek, C.L.; Prasad, G.M.; Viswanathan, V.; Armstrong, D.G.; Gourdie, R.G.; Ghatnekar, G.S. Topical administration of a connexin 43-based peptide augments healing of chronic neuropathic diabetic foot ulcers: A multicenter, randomized trial. Wound Repair Regen. 2015, 23, 203–212. [Google Scholar] [CrossRef]
- Mugisho, O.O.; Green, C.R.; Zhang, J.; Acosta, M.L.; Rupenthal, I.D. Connexin 43 hemichannels: A potential drug target for the treatment of diabetic retinopathy. Drug Discov. Today 2019, 24, 1627–1636. [Google Scholar] [CrossRef]
- Ghatnekar, G.S.; Grek, C.L.; Armstrong, D.G.; Desai, S.C.; Gourdie, R.G. The effect of a connexin 43-based Peptide on the healing of chronic venous leg ulcers: A multicenter, randomized trial. J. Invest. Dermatol. 2015, 135, 289–298. [Google Scholar] [CrossRef] [Green Version]
- Grek, C.L.; Rhett, J.M.; Bruce, J.S.; Abt, M.A.; Ghatnekar, G.S.; Yeh, E.S. Targeting connexin 43 with alpha-connexin carboxyl-terminal (ACT1) peptide enhances the activity of the targeted inhibitors, tamoxifen and lapatinib, in breast cancer: Clinical implication for ACT1. BMC Cancer 2015, 15, 296. [Google Scholar] [CrossRef] [Green Version]
- Montgomery, J.; Richardson, W.J.; Marsh, S.; Rhett, J.M.; Bustos, F.; Degen, K.; Ghatnekar, G.S.; Grek, C.L.; Jourdan, L.J.; Holmes, J.W.; et al. The connexin 43 carboxyl terminal mimetic peptide alphaCT1 prompts differentiation of a collagen scar matrix in humans resembling unwounded skin. FASEB J. 2021, 35, e21762. [Google Scholar] [CrossRef]
- Strauss, R.E.; Mezache, L.; Veeraraghavan, R.; Gourdie, R.G. The Cx43 carboxyl-terminal mimetic peptide αCT1 protects endothelial barrier function in a ZO1 binding-competent manner. Biomolecules 2021, 11, 1192. [Google Scholar] [CrossRef] [PubMed]
- Rhett, J.M.; Yeh, E.S. The Potential for Connexin Hemichannels to Drive Breast Cancer Progression through Regulation of the Inflammatory Response. Int. J. Mol. Sci. 2018, 19, 1043. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Soder, B.L.; Propst, J.T.; Brooks, T.M.; Goodwin, R.L.; Friedman, H.I.; Yost, M.J.; Gourdie, R.G. The connexin 43 carboxyl-terminal peptide ACT1 modulates the biological response to silicone implants. Plast Reconstr. Surg. 2009, 123, 1440–1451. [Google Scholar] [CrossRef] [PubMed]
- Roskoski, R., Jr. Src protein-tyrosine kinase structure and regulation. Biochem. Biophys. Res. Commun. 2004, 324, 1155–1164. [Google Scholar] [CrossRef] [PubMed]
- Kanemitsu, M.Y.; Loo, L.W.; Simon, S.; Lau, A.F.; Eckhart, W. Tyrosine phosphorylation of connexin 43 by v-Src is mediated by SH2 and SH3 domain interactions. J. Biol. Chem. 1997, 272, 22824–22831. [Google Scholar] [CrossRef] [Green Version]
- Gangoso, E.; Thirant, C.; Chneiweiss, H.; Medina, J.M.; Tabernero, A. A cell-penetrating peptide based on the interaction between c-Src and connexin 43 reverses glioma stem cell phenotype. Cell Death Dis. 2014, 5, e1023. [Google Scholar] [CrossRef]
- Han, X.; Zhang, W.; Yang, X.; Wheeler, C.G.; Langford, C.P.; Wu, L.; Filippova, N.; Friedman, G.K.; Ding, Q.; Fathallah-Shaykh, H.M.; et al. The role of Src family kinases in growth and migration of glioma stem cells. Int. J. Oncol. 2014, 45, 302–310. [Google Scholar] [CrossRef] [Green Version]
- Singh, S.; Trevino, J.; Bora-Singhal, N.; Coppola, D.; Haura, E.; Altiok, S.; Chellappan, S.P. EGFR/Src/Akt signaling modulates Sox2 expression and self-renewal of stem-like side-population cells in non-small cell lung cancer. Mol. Cancer 2012, 11, 73. [Google Scholar] [CrossRef] [Green Version]
- Gangoso, E.; Talaveron, R.; Jaraiz-Rodriguez, M.; Dominguez-Prieto, M.; Ezan, P.; Koulakoff, A.; Medina, J.M.; Giaume, C.; Tabernero, A. A c-Src Inhibitor Peptide Based on Connexin 43 Exerts Neuroprotective Effects through the Inhibition of Glial Hemichannel Activity. Front. Mol. Neurosci. 2017, 10, 418. [Google Scholar] [CrossRef] [Green Version]
- He, D.; Li, H. Bifunctional Cx43 Mimic Peptide Grafted Hyaluronic Acid Hydrogels Inhibited Tumor Recurrence and Stimulated Wound Healing for Postsurgical Tumor Treatment. Adv. Funct. Mater. 2020, 30, 2004709. [Google Scholar] [CrossRef]
- Lamouille, S.; Smyth, J.W.; O’Rourke, L.; Kanabur, P.; Guo, S.; Jourdan, J.; Sheng, Z.; Gourdie, R.G. Abstract 4765: Targeting glioblastoma cancer stem cells with a novel Connexin 43 mimetic peptide. In Proceedings of the AACR Annual Meeting 2017, Washington, DC, USA, 1–5 April 2017. [Google Scholar] [CrossRef]
- Sheng, Z. Connexin 43 peptidic medicine for glioblastoma stem cells. EBioMedicine 2021, 64, 103205. [Google Scholar] [CrossRef]
- Grosely, R.; Kopanic, J.L.; Nabors, S.; Kieken, F.; Spagnol, G.; Al-Mugotir, M.; Zach, S.; Sorgen, P.L. Effects of phosphorylation on the structure and backbone dynamics of the intrinsically disordered connexin 43 C-terminal domain. J. Biol. Chem. 2013, 288, 24857–24870. [Google Scholar] [CrossRef] [Green Version]
- Solan, J.L.; Lampe, P.D. Specific Cx43 phosphorylation events regulate gap junction turnover in vivo. FEBS Lett. 2014, 588, 1423–1429. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Liao, C.K.; Cheng, H.H.; Wang, S.D.; Yeih, D.F.; Wang, S.M. PKCɛ mediates serine phosphorylation of connexin 43 induced by lysophosphatidylcholine in neonatal rat cardiomyocytes. Toxicology 2013, 314, 11–21. [Google Scholar] [CrossRef]
- Solan, J.L.; Lampe, P.D. Kinase programs spatiotemporally regulate gap junction assembly and disassembly: Effects on wound repair. Semin Cell Dev. Biol. 2016, 50, 40–48. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Acosta, M.L.; Mat Nor, M.N.; Guo, C.X.; Mugisho, O.O.; Coutinho, F.P.; Rupenthal, I.D.; Green, C.R. Connexin therapeutics: Blocking connexin hemichannel pores is distinct from blocking pannexin channels or gap junctions. Neural Regen. Res. 2021, 16, 482–488. [Google Scholar] [CrossRef] [PubMed]
- Michalski, K.; Syrjanen, J.L.; Henze, E.; Kumpf, J.; Furukawa, H.; Kawate, T. The cryo-EM structure of a pannexin 1 reveals unique motifs for ion selection and inhibition. Elife 2020, 9, e54670. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Qu, R.; Dong, L.; Zhang, J.; Yu, X.; Wang, L.; Zhu, S. Cryo-EM structure of human heptameric Pannexin 1 channel. Cell Res. 2020, 30, 446–448. [Google Scholar] [CrossRef] [PubMed]
- Willebrords, J.; Maes, M.; Crespo Yanguas, S.; Vinken, M. Inhibitors of connexin and pannexin channels as potential therapeutics. Pharmacol. Ther. 2017, 180, 144–160. [Google Scholar] [CrossRef] [Green Version]
- Billaud, M.; Lohman, A.W.; Straub, A.C.; Looft-Wilson, R.; Johnstone, S.R.; Araj, C.A.; Best, A.K.; Chekeni, F.B.; Ravichandran, K.S.; Penuela, S.; et al. Pannexin1 Regulates alpha 1-Adrenergic Receptor-Mediated Vasoconstriction. Circ. Res. 2011, 109, 80–85. [Google Scholar] [CrossRef] [Green Version]
- Billaud, M.; Chiu, Y.H.; Lohman, A.W.; Parpaite, T.; Butcher, J.T.; Mutchler, S.M.; DeLalio, L.J.; Artamonov, M.V.; Sandilos, J.K.; Best, A.K.; et al. A molecular signature in the pannexin1 intracellular loop confers channel activation by the alpha1 adrenoreceptor in smooth muscle cells. Sci. Signal. 2015, 8, ra17. [Google Scholar] [CrossRef] [Green Version]
- Weilinger, N.L.; Tang, P.L.; Thompson, R.J. Anoxia-induced NMDA receptor activation opens pannexin channels via Src family kinases. J. Neurosci. 2012, 32, 12579–12588. [Google Scholar] [CrossRef]
- Weilinger, N.L.; Lohman, A.W.; Rakai, B.D.; Ma, E.M.; Bialecki, J.; Maslieieva, V.; Rilea, T.; Bandet, M.V.; Ikuta, N.T.; Scott, L.; et al. Metabotropic NMDA receptor signaling couples Src family kinases to pannexin-1 during excitotoxicity. Nat. Neurosci. 2016, 19, 432–442. [Google Scholar] [CrossRef] [PubMed]
- Diezmos, E.F.; Markus, I.; Perera, D.S.; Gan, S.; Zhang, L.; Sandow, S.L.; Bertrand, P.P.; Liu, L. Blockade of Pannexin-1 Channels and Purinergic P2X7 Receptors Shows Protective Effects Against Cytokines-Induced Colitis of Human Colonic Mucosa. Front. Pharmacol. 2018, 9, 865. [Google Scholar] [CrossRef]
- Shoji, K.F.; Sáez, P.J.; Harcha, P.A.; Aguila, H.L.; Sáez, J.C. Pannexin1 channels act downstream of P2X 7 receptors in ATP-induced murine T-cell death. Channels 2014, 8, 142–156. [Google Scholar] [CrossRef] [Green Version]
- Garré, J.M.; Yang, G.; Bukauskas, F.F.; Bennett, M.V. FGF-1 Triggers Pannexin-1 Hemichannel Opening in Spinal Astrocytes of Rodents and Promotes Inflammatory Responses in Acute Spinal Cord Slices. J. Neurosci. 2016, 36, 4785–4801. [Google Scholar] [CrossRef] [PubMed]
- Huang, G.Y.; Xie, L.J.; Linask, K.L.; Zhang, C.; Zhao, X.Q.; Yang, Y.; Zhou, G.M.; Wu, Y.J.; Marquez-Rosado, L.; McElhinney, D.B.; et al. Evaluating the role of connexin 43 in congenital heart disease: Screening for mutations in patients with outflow tract anomalies and the analysis of knock-in mouse models. J. Cardiovasc Dis. Res. 2011, 2, 206–212. [Google Scholar] [CrossRef] [Green Version]
- Salameh, A.; Blanke, K.; Daehnert, I. Role of connexins in human congenital heart disease: The chicken and egg problem. Front. Pharmacol. 2013, 4, 70. [Google Scholar] [CrossRef] [Green Version]
- Delmar, M.; Makita, N. Cardiac connexins, mutations and arrhythmias. Curr Opin Cardiol. 2012, 27, 236–241. [Google Scholar] [CrossRef] [PubMed]
- Boengler, K.; Schulz, R. Connexin 43 and Mitochondria in Cardiovascular Health and Disease. Adv. Exp. Med. Biol. 2017, 982, 227–246. [Google Scholar] [CrossRef]
- Srinivas, M.; Verselis, V.K.; White, T.W. Human diseases associated with connexin mutations. Biochim. Biophys. Acta Biomembr. 2018, 1860, 192–201. [Google Scholar] [CrossRef] [PubMed]
- Fetoni, A.R.; Zorzi, V.; Paciello, F.; Ziraldo, G.; Peres, C.; Raspa, M.; Scavizzi, F.; Salvatore, A.M.; Crispino, G.; Tognola, G.; et al. Cx26 partial loss causes accelerated presbycusis by redox imbalance and dysregulation of Nfr2 pathway. Redox Biol. 2018, 19, 301–317. [Google Scholar] [CrossRef] [PubMed]
- Beach, R.; Abitbol, J.M.; Allman, B.L.; Esseltine, J.L.; Shao, Q.; Laird, D.W. GJB2 Mutations Linked to Hearing Loss Exhibit Differential Trafficking and Functional Defects as Revealed in Cochlear-Relevant Cells. Front. Cell Dev. Biol. 2020, 8, 215. [Google Scholar] [CrossRef] [PubMed]
- Shuja, Z.; Li, L.; Gupta, S.; Mese, G.; White, T.W. Connexin 26 Mutations Causing Palmoplantar Keratoderma and Deafness Interact with Connexin 43, Modifying Gap Junction and Hemichannel Properties. J. Invest. Dermatol. 2016, 136, 225–235. [Google Scholar] [CrossRef] [Green Version]
- Maestrini, E.; Korge, B.P.; Ocana-Sierra, J.; Calzolari, E.; Cambiaghi, S.; Scudder, P.M.; Hovnanian, A.; Monaco, A.P.; Munro, C.S. A missense mutation in connexin 26, D66H, causes mutilating keratoderma with sensorineural deafness (Vohwinkel’s syndrome) in three unrelated families. Hum. Mol. Genet. 1999, 8, 1237–1243. [Google Scholar] [CrossRef] [Green Version]
- Yang, S.H.; Clemett, C.A.; Brimble, M.A.; O’Carroll, S.J.; Harris, P.W.R. Synthesis and biological evaluation of S-lipidated lipopeptides of a connexin 43 channel inhibitory peptide. RSC Med. Chem. 2020, 11, 1041–1047. [Google Scholar] [CrossRef]
- Marsh, S.R.; Pridham, K.J.; Jourdan, J.; Gourdie, R.G. Novel Protocols for Scalable Production of High Quality Purified Small Extracellular Vesicles from Bovine Milk. Nanotheranostics 2021, 5, 488–498. [Google Scholar] [CrossRef]
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
King, D.R.; Sedovy, M.W.; Leng, X.; Xue, J.; Lamouille, S.; Koval, M.; Isakson, B.E.; Johnstone, S.R. Mechanisms of Connexin Regulating Peptides. Int. J. Mol. Sci. 2021, 22, 10186. https://0-doi-org.brum.beds.ac.uk/10.3390/ijms221910186
King DR, Sedovy MW, Leng X, Xue J, Lamouille S, Koval M, Isakson BE, Johnstone SR. Mechanisms of Connexin Regulating Peptides. International Journal of Molecular Sciences. 2021; 22(19):10186. https://0-doi-org.brum.beds.ac.uk/10.3390/ijms221910186
Chicago/Turabian StyleKing, D. Ryan, Meghan W. Sedovy, Xinyan Leng, Jianxiang Xue, Samy Lamouille, Michael Koval, Brant E. Isakson, and Scott R. Johnstone. 2021. "Mechanisms of Connexin Regulating Peptides" International Journal of Molecular Sciences 22, no. 19: 10186. https://0-doi-org.brum.beds.ac.uk/10.3390/ijms221910186