HBV Pre-S1-Derived Myristoylated Peptide (Myr47): Identification of the Inhibitory Activity on the Cellular Uptake of Lipid Nanoparticles
Abstract
:1. Introduction
2. Materials and Methods
2.1. Materials
2.2. Cell Culture
2.3. Liposomes (LPs)
2.4. Confocal Laser Microscopy
2.5. Flow Cytometry
2.6. Alphascreen® Assay
2.7. Bio-Layer-Interferometry (BLI) Analysis
3. Results
3.1. Inhibition of Cellular Uptake of Liposomes (LPs) by Myr47
3.2. N-Myristoylation-Dependent Interaction between Myr47 and LPs
3.3. Effect of Amino Acid Sequence on the Myr47-Mediated Inhibitory Activity
3.4. Effect of Myr47 on the ApoE3 (Apolipoprotein E3)-LPs Interaction
3.5. Effect of Myr47 on the Cellular Uptake of HBsAg
4. Discussion
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Conflicts of Interest
References
- Neuveut, C.; Wei, Y.; Buendia, M.A. Mechanisms of HBV-related hepatocarcinogenesis. J. Hepatol. 2010, 52, 594–604. [Google Scholar] [CrossRef] [Green Version]
- Heermann, K.H.; Goldmann, U.; Schwartz, W.; Seyffarth, T.; Baumgarten, H.; Gerlich, W.H. Large surface proteins of hepatitis B virus containing the pre-s sequence. J. Virol. 1984, 52, 396–402. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Neurath, A.R.; Kent, S.B.H.; Strick, N.; Parker, K. Identification and chemical synthesis of a host cell receptor binding site on hepatitis B virus. Cell 1986, 46, 429–436. [Google Scholar] [CrossRef]
- Pontisso, P.; Ruvoletto, M.G.; Gerlich, W.H.; Heermann, K.H.; Bardini, R.; Alberti, A. Identification of an attachment site for human liver plasma membranes on hepatitis B virus particles. Virology 1989, 173, 522–530. [Google Scholar] [CrossRef]
- Klingmüller, U.; Schaller, H. Hepadnavirus infection requires interaction between the viral pre-S domain and a specific hepatocellular receptor. J. Virol. 1993, 67, 7414–7422. [Google Scholar] [CrossRef] [Green Version]
- Seyec, J.L.; Chouteau, P.; Cannie, I.; Guguen-Guillouzo, C.; Gripon, P. Infection process of the hepatitis B virus depends on the presence of a defined sequence in the pre-S1 domain. J. Virol. 1999, 73, 2052–2057. [Google Scholar] [CrossRef] [Green Version]
- Gripon, P.; Le Seyec, J.; Rumin, S.; Guguen-guillouzo, C. Myristylation of the hepatitis B virus large surface protein is essential for viral infectivity. Virology 1995, 213, 292–299. [Google Scholar] [CrossRef]
- Bruss, V.; Hagelstein, J.; Gerhardt, E.; Galle, P.R. Myristylation of the large surface protein is required for hepatitis B virus in vitro infectivity. Virology 1996, 218, 396–399. [Google Scholar] [CrossRef] [Green Version]
- Glebe, D.; Urban, S.; Knoop, E.V.; Çaǧ, N.; Krass, P.; Grun, S.; Bulavaite, A.; Sasnauskas, K.; Gerlich, W.H. Mapping of the hepatitis B virus attachment site by use of infection-inhibiting preS1 lipopeptides and Tupaia hepatocytes. Gastroenterology 2005, 129, 234–245. [Google Scholar] [CrossRef]
- Yan, H.; Zhong, G.; Xu, G.; He, W.; Jing, Z.; Gao, Z.; Li, W.; Yi, H.; Qi, Y.; Peng, B. Sodium taurocholate cotransporting polypeptide is a functional receptor for human hepatitis B and D virus. eLife 2012, 1, e00049. [Google Scholar] [CrossRef]
- Somiya, M.; Liu, Q.; Yoshimoto, N.; Iijima, M.; Tatematsu, K.; Nakai, T.; Kuroda, S.I. Cellular uptake of hepatitis B virus envelope L particles is independent of sodium taurocholate cotransporting polypeptide, but dependent on heparan sulfate proteoglycan. Virology 2016, 497, 23–32. [Google Scholar] [CrossRef]
- Qiao, L.; Luo, G.G. Human apolipoprotein E promotes hepatitis B virus infection and production. PLoS Pathog. 2019, 15, e1007874. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yan, X.; Kuipers, F.; Havekes, L.M.; Havinga, R.; Dontje, B.; Poelstra, K.; Scherphof, G.L.; Kamps, J.A.A.M. The role of apolipoprotein E in the elimination of liposomes from blood by hepatocytes in the mouse. Biochem. Biophys. Res. Commun. 2005, 328, 57–62. [Google Scholar] [CrossRef] [PubMed]
- Schulze, A.; Schieck, A.; Ni, Y.; Mier, W.; Urban, S. Fine mapping of pre-S sequence requirements for hepatitis B virus large envelope protein-mediated receptor interaction. J. Virol. 2010, 84, 1989–2000. [Google Scholar] [CrossRef] [Green Version]
- Seethala, R.; Prabhavathi, F. Homogeneous Assays: AlphaScreen. In Handbook of Drug Screening; Marcel Dekker: New York, NY, USA, 2001; pp. 106–110. [Google Scholar]
- Johnson, D.R.; Bhatnagar, R.S.; Knoll, L.J.; Gordon, J.I. Genetic and biochemical studies of protein N-myristoylation. Ann. Rev. Biochem. 1994, 63, 869–914. [Google Scholar] [CrossRef]
- Mahley, R.W.; Ji, Z.S. Remnant lipoprotein metabolism: Key pathways involving cell-surface heparan sulfate proteoglycans and apolipoprotein E. J. Lipid Res. 1999, 40, 1–16. [Google Scholar] [CrossRef]
- Murray, D.; Ben-Tal, N.; Honig, B.; McLaughlin, S. Electrostatic interaction of myristoylated proteins with membranes: Simple physics, complicated biology. Structure 1997, 5, 985–989. [Google Scholar] [CrossRef] [Green Version]
- Zhang, Z.; Zehnder, B.; Damrau, C.; Urban, S. Visualization of hepatitis B virus entry novel tools and approaches to directly follow virus entry into hepatocytes. FEBS Lett. 2016, 590, 1915–1926. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Fujita, K.; Somiya, M.; Kuroda, S.; Hinuma, S. Induction of lipid droplets in non-macrophage cells as well as macrophages by liposomes and exosomes. Biochem. Biophys. Res. Commun. 2019, 510, 184–190. [Google Scholar] [CrossRef] [PubMed]
- Fujita, K.; Koide, N.; Somiya, M.; Kuroda, S.; Hinuma, S. A regulatory role of scavenger receptor class B type 1 in endocytosis and lipid droplet formation induced by liposomes containing phosphatidylethanolamine in HEK293T cells. Biochim. Biophys. Acta Mol. Cell. Res. 2021, 1868, 118859. [Google Scholar] [CrossRef] [PubMed]
- Koide, N.; Fujita, K.; Kuroda, S.; Hinuma, S. Binding of liposomes composed of phosphatidylcholine to scavenger receptor class B type 1 and its modulation by phosphatidic acid in HEK293T cells. Biochim. Biophys. Acta Mol. Cell. Res. 2021, 1868, 119043. [Google Scholar] [CrossRef] [PubMed]
- Izdebska, M.; Piątkowska-Chmiel, I.; Korolczuk, A.; Herbet, M.; Gawrońska-Grzywacz, M.; Gieroba, R.; Sysa, M.; Czajkowska-Bania, K.; Cygal, M.; Korga, A.; et al. The beneficial effects of resveratrol on steatosis and mitochondrial oxidative stress in HepG2 cells. Can. J. Physiol. Pharmacol. 2017, 95, 1442–1453. [Google Scholar] [CrossRef] [PubMed]
- Xiong, J.; Zhang, H.; Wang, Y.; Wang, A.; Bian, J.; Huang, H.; Zheng, Y.; Sang, X.; Xu, Y.; Lu, X.; et al. Hepatitis B virus infection and the risk of nonalcoholic fatty liver disease: A meta-analysis. Oncotarget 2017, 8, 107295–107302. [Google Scholar] [CrossRef] [PubMed] [Green Version]
Name | Sequence |
---|---|
Myr47 | Myr-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVK-biotin |
aa2–48 | GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVK-biotin |
Ala11–15 | Myr-GTNLSVPNPAAAAADHQLDPAFGANSNNPDWDFNPNKDQWPEANQVK-biotin |
d-11,13 | Myr-GTNLSVPNLFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVK-biotin |
Scrambled (Scr) | Myr-TNNDPFKRTDLAWNGFDSVAQNDLLPNPPFNNWGDGSHQPADAKPFTK-biotin |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Nanahara, M.; Chang, Y.-T.; Somiya, M.; Kuroda, S. HBV Pre-S1-Derived Myristoylated Peptide (Myr47): Identification of the Inhibitory Activity on the Cellular Uptake of Lipid Nanoparticles. Viruses 2021, 13, 929. https://0-doi-org.brum.beds.ac.uk/10.3390/v13050929
Nanahara M, Chang Y-T, Somiya M, Kuroda S. HBV Pre-S1-Derived Myristoylated Peptide (Myr47): Identification of the Inhibitory Activity on the Cellular Uptake of Lipid Nanoparticles. Viruses. 2021; 13(5):929. https://0-doi-org.brum.beds.ac.uk/10.3390/v13050929
Chicago/Turabian StyleNanahara, Masaya, Ya-Ting Chang, Masaharu Somiya, and Shun’ichi Kuroda. 2021. "HBV Pre-S1-Derived Myristoylated Peptide (Myr47): Identification of the Inhibitory Activity on the Cellular Uptake of Lipid Nanoparticles" Viruses 13, no. 5: 929. https://0-doi-org.brum.beds.ac.uk/10.3390/v13050929