Heat-Stable Hazelnut Profilin: Molecular Dynamics Simulations and Immunoinformatics Analysis
Abstract
:1. Introduction
2. Materials and Methods
2.1. Protein Preparation
2.2. Molecular Dynamics Simulation
2.3. Immunoinformatic Details
3. Results and Discussion
3.1. MD Simulation Analysis
3.2. Immunoinformatics
4. Conclusions
Supplementary Materials
Author Contributions
Funding
Conflicts of Interest
References
- Fideghelli, C.; De Salvador, F. World hazelnut situation and perspectives. Acta Horticulturae 2009, 845, 39–51. [Google Scholar] [CrossRef]
- Bitok, E.; Sabate, J. Nuts and cardiovascular disease. Prog. Cardiovasc. Dis. 2018, 61, 33–37. [Google Scholar] [CrossRef] [PubMed]
- Mazidi, M.; Rezaie, P.; Ferns, G.A.; Gao, H.K. Impact of different types of tree nut, peanut, and soy nut consumption on serum C-reactive protein (CRP): A systematic review and meta-analysis of randomized controlled clinical trials. Medicine 2016, 95, e5165. [Google Scholar] [CrossRef] [PubMed]
- Atanasov, A.G.; Sabharanjak, S.M.; Zengin, G.; Mollica, A.; Szostak, A.; Simirgiotis, M.; Huminiecki, Ł.; Horbanczuk, O.K.; Nabavi, S.M.; Mocan, A. Pecan nuts: A review of reported bioactivities and health effects. Trends Food Sci. Technol. 2018, 71, 246–257. [Google Scholar] [CrossRef]
- Carey, A.N.; Poulose, S.M.; Shukitt-Hale, B. The beneficial effects of tree nuts on the aging brain. Nutr. Aging 2012, 1, 55–67. [Google Scholar] [CrossRef] [Green Version]
- Gorji, N.; Moeini, R.; Memariani, Z. Almond, hazelnut and walnut, three nuts for neuroprotection in Alzheimer’s disease: A neuropharmacological review of their bioactive constituents. Pharmacol. Res. 2018, 129, 115–127. [Google Scholar] [CrossRef] [PubMed]
- Hernández-Alonso, P.; Camacho-Barcia, L.; Bulló, M.; Salas-Salvadó, J. Nuts and dried fruits: An update of their beneficial effects on type 2 diabetes. Nutrients 2017, 9, 673. [Google Scholar] [CrossRef] [Green Version]
- Jeong, K.; Lee, S.Y.; Ahn, K.; Kim, J.; Lee, H.R.; Suh, D.; Pyun, B.Y.; Min, T.; Kwon, J.W.; Kim, K.E. A multicenter study on anaphylaxis caused by peanut, tree nuts, and seeds in children and adolescents. Allergy 2017, 72, 507–510. [Google Scholar] [CrossRef]
- Flinterman, A.E.; Akkerdaas, J.H.; Knulst, A.C.; Van Ree, R.; Pasmans, S.G. Hazelnut allergy: From pollen-associated mild allergy to severe anaphylactic reactions. Curr. Opin. Allergy Clin. Immunol. 2008, 8, 261–265. [Google Scholar] [CrossRef]
- Fleischer, D.M.; Conover-Walker, M.K.; Matsui, E.C.; Wood, R.A. The natural history of tree nut allergy. J. Allergy Clin. Immunol. 2005, 116, 1087–1093. [Google Scholar] [CrossRef]
- Lauer, I.; Foetisch, K.; Kolarich, D.; Ballmer-Weber, B.K.; Conti, A.; Altmann, F.; Vieths, S.; Scheurer, S. Hazelnut (Corylus avellana) vicilin Cor a 11: Molecular characterization of a glycoprotein and its allergenic activity. Biochem. J. 2004, 383, 327–334. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Masthoff, L.J.; Mattsson, L.; Zuidmeer-Jongejan, L.; Lidholm, J.; Andersson, K.; Akkerdaas, J.H.; Versteeg, S.A.; Garino, C.; Meijer, Y.; Kentie, P.; et al. Sensitization to Cor a 9 and Cor a 14 is highly specific for a hazelnut allergy with objective symptoms in Dutch children and adults. J. Allergy Clin. Immunol. 2013, 132, 393–399. [Google Scholar] [CrossRef] [PubMed]
- Hirschwehr, R.; Valenta, R.; Ebner, C.; Ferreira, F.; Sperr, W.R.; Valent, P.; Rohac, M.; Rumpold, H.; Scheiner, O.; Kraft, D. Identification of common allergenic structures in hazel pollen and hazelnuts: A possible explanation for sensitivity to hazelnuts in patients allergic to tree pollen. J. Allergy Clin. Immunol. 1992, 90, 927–936. [Google Scholar] [CrossRef]
- Valenta, R.; Duchene, M.; Ebner, C.; Valent, P.; Sillaber, C.; Deviller, P.; Ferreira, F.; Tejkl, M.; Edelmann, H.; Kraft, D. Profilins constitute a novel family of functional plant pan-allergens. J. Exp. Med. 1992, 175, 377–385. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Costa, J.; Mafra, I.; Carrapatoso, I.; Oliveira, M.B.P. Hazelnut allergens: Molecular characterization, detection, and clinical relevance. Crit. Rev. Food Sci. Nutr. 2016, 56, 2579–2605. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Datema, M.R.; Zuidmeer-Jongejan, L.; Asero, R.; Barreales, L.; Belohlavkova, S.; de Blay, F.; Bures, P.; Clausen, M.; Dubakiene, R.; Gislason, D.; et al. Hazelnut allergy across Europe dissected molecularly: A EuroPrevall outpatient clinic survey. J. Allergy Clin. Immunol. 2015, 136, 382–391. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Verhoeckx, K.C.; Vissers, Y.M.; Baumert, J.L.; Faludi, R.; Feys, M.; Flanagan, S.; Herouet-Guicheney, C.; Holzhauser, T.; Shimojo, R.; van der Bolt, N. Food processing and allergenicity. Food Chem. Toxicol. 2015, 80, 223–240. [Google Scholar] [CrossRef]
- Müller, U.; Lüttkopf, D.; Hoffmann, A.; Petersen, A.; Becker, W.; Schocker, F.; Niggemann, B.; Altmann, F.; Kolarich, D.; Haustein, D. Allergens in raw and roasted hazelnuts (Corylus avellana) and their cross-reactivity to pollen. Eur. Food Res. Technol. 2000, 212, 2–12. [Google Scholar] [CrossRef]
- Wigotzki, M.; Steinhart, H.; Paschke, A. Influence of varieties, storage and heat treatment on IgE-binding proteins in hazelnuts (Corylus avellana). Food Agric. Immunol. 2000, 12, 217–229. [Google Scholar] [CrossRef]
- Vogt, G.; Argos, P. Protein thermal stability: Hydrogen bonds or internal packing? Fold. Des. 1997, 2, S40–S46. [Google Scholar] [CrossRef] [Green Version]
- Querol, E.; Perez-Pons, J.A.; Mozo-Villarias, A. Analysis of protein conformational characteristics related to thermostability. Protein Eng. Des. Sel. 1996, 9, 265–271. [Google Scholar] [CrossRef] [PubMed]
- Kim, T.D.; Ryu, H.J.; Cho, H.I.; Yang, C.H.; Kim, J. Thermal behavior of proteins: Heat-resistant proteins and their heat-induced secondary structural changes. Biochemistry 2000, 39, 14839–14846. [Google Scholar] [CrossRef] [PubMed]
- Xu, X.; Su, J.; Chen, W.; Wang, C. Thermal stability and unfolding pathways of Sso7d and its mutant F31A: Insight from molecular dynamics simulation. J. Biomol. Struct. Dyn. 2011, 28, 717–727. [Google Scholar] [CrossRef] [PubMed]
- Chen, L.; Li, X.; Wang, R.; Fang, F.; Yang, W.; Kan, W. Thermal stability and unfolding pathways of hyperthermophilic and mesophilic periplasmic binding proteins studied by molecular dynamics simulation. J. Biomol. Struct. Dyn. 2016, 34, 1576–1589. [Google Scholar] [CrossRef]
- Chen, G.; Huang, K.; Miao, M.; Feng, B.; Campanella, O.H. Molecular dynamics simulation for mechanism elucidation of food processing and safety: State of the art. Compr. Rev. Food Sci. Food Saf. 2019, 18, 243–263. [Google Scholar] [CrossRef] [Green Version]
- Childers, M.C.; Daggett, V. Insights from molecular dynamics simulations for computational protein design. Mol. Syst. Des. Eng. 2017, 2, 9–33. [Google Scholar] [CrossRef] [Green Version]
- Vanga, S.K.; Wang, J.; Singh, A.; Raghavan, V. Simulations of Temperature and Pressure Unfolding in Soy Allergen Gly m 4 Using Molecular Modeling. J. Agric. Food Chem. 2019, 67, 12547–12557. [Google Scholar] [CrossRef]
- Tiwari, V.; Mitra, D.; Tiwari, M. Investigation of the interaction of allergens of Glycine max with IgE-antibody for designing of peptidomimetics based anti-allergen. Int. Immunopharmacol. 2018, 61, 394–404. [Google Scholar] [CrossRef]
- Apostolovic, D.; Stanic-Vucinic, D.; De Jongh, H.H.; De Jong, G.A.; Mihailovic, J.; Radosavljevic, J.; Radibratovic, M.; Nordlee, J.A.; Baumert, J.L.; Milcic, M.; et al. Conformational stability of digestion-resistant peptides of peanut conglutins reveals the molecular basis of their allergenicity. Sci. Rep. 2016, 6, 29249. [Google Scholar] [CrossRef]
- Waterhouse, A.; Bertoni, M.; Bienert, S.; Studer, G.; Tauriello, G.; Gumienny, R.; Heer, F.T.; de Beer, T.A.P.; Rempfer, C.; Bordoli, L. SWISS-MODEL: Homology modelling of protein structures and complexes. Nucleic Acids Res. 2018, 46, W296–W303. [Google Scholar] [CrossRef] [Green Version]
- Barazorda-Ccahuana, H.L.; Valencia, D.E.; Aguilar-Pineda, J.A.; Gómez, B. Art v 4 Protein Structure as a Representative Template for Allergen Profilins: Homology Modeling and Molecular Dynamics. ACS Omega 2018, 3, 17254–17260. [Google Scholar] [CrossRef]
- Van Der Spoel, D.; Lindahl, E.; Hess, B.; Groenhof, G.; Mark, A.E.; Berendsen, H.J. GROMACS: Fast, flexible, and free. J. Comput. Chem. 2005, 26, 1701–1718. [Google Scholar] [CrossRef] [PubMed]
- Jorgensen, W.L.; Maxwell, D.S.; Tirado-Rives, J. Development and testing of the OPLS all-atom force field on conformational energetics and properties of organic liquids. J. Am. Chem. Soc. 1996, 118, 11225–11236. [Google Scholar] [CrossRef]
- Abascal, J.L.; Vega, C. A general purpose model for the condensed phases of water: TIP4P/2005. J. Chem. Phys. 2005, 123, 234505. [Google Scholar] [CrossRef] [PubMed]
- Hess, B.; Bekker, H.; Berendsen, H.J.; Fraaije, J.G. LINCS: A linear constraint solver for molecular simulations. J. Comput. Chem. 1997, 18, 1463–1472. [Google Scholar] [CrossRef]
- Essmann, U.; Perera, L.; Berkowitz, M.L.; Darden, T.; Lee, H.; Pedersen, L.G. A smooth particle mesh Ewald method. J. Chem. Phys. 1995, 103, 8577–8593. [Google Scholar] [CrossRef] [Green Version]
- Humphrey, W.; Dalke, A.; Schulten, K. VMD: Visual molecular dynamics. J. Mol. Graph. 1996, 14, 33–38. [Google Scholar] [CrossRef]
- Pettersen, E.F.; Goddard, T.D.; Huang, C.C.; Couch, G.S.; Greenblatt, D.M.; Meng, E.C.; Ferrin, T.E. UCSF Chimera—A visualization system for exploratory research and analysis. J. Comput. Chem. 2004, 25, 1605–1612. [Google Scholar] [CrossRef] [Green Version]
- Ponomarenko, J.; Bui, H.H.; Li, W.; Fusseder, N.; Bourne, P.E.; Sette, A.; Peters, B. ElliPro: A new structure-based tool for the prediction of antibody epitopes. BMC Bioinform. 2008, 9, 514. [Google Scholar] [CrossRef] [Green Version]
- Negi, S.S.; Braun, W. Cross-React: A new structural bioinformatics method for predicting allergen cross-reactivity. Bioinformatics 2016, 33, 1014–1020. [Google Scholar] [CrossRef] [Green Version]
- Mares-Mejía, I.; Martínez-Caballero, S.; Garay-Canales, C.; Cano-Sánchez, P.; Torres-Larios, A.; Lara-González, S.; Ortega, E.; Rodríguez-Romero, A. Structural insights into the IgE mediated responses induced by the allergens Hev b 8 and Zea m 12 in their dimeric forms. Sci. Rep. 2016, 6, 32552. [Google Scholar] [CrossRef] [PubMed]
- Kirkpatrick, S.; Gelatt, C.D.; Vecchi, M.P. Optimization by simulated annealing. Science 1983, 220, 671–680. [Google Scholar] [CrossRef] [PubMed]
- Price, M.L.; Ostrovsky, D.; Jorgensen, W.L. Gas-phase and liquid-state properties of esters, nitriles, and nitro compounds with the OPLS-AA force field. J. Comput. Chem. 2001, 22, 1340–1352. [Google Scholar] [CrossRef]
- Robertson, M.J.; Tirado-Rives, J.; Jorgensen, W.L. Improved peptide and protein torsional energetics with the OPLS-AA force field. J. Chem. Theory Comput. 2015, 11, 3499–3509. [Google Scholar] [CrossRef]
- Jorgensen, W.L.; Chandrasekhar, J.; Madura, J.D.; Impey, R.W.; Klein, M.L. Comparison of simple potential functions for simulating liquid water. J. Chem. Phys. 1983, 79, 926–935. [Google Scholar] [CrossRef]
- Reddy, M.R.; Berkowitz, M. Structure and dynamics of high-pressure TIP4P water. J. Chem. Phys. 1987, 87, 6682–6686. [Google Scholar] [CrossRef]
- Jorgensen, W.L.; Jenson, C. Temperature dependence of TIP3P, SPC, and TIP4P water from NPT Monte Carlo simulations: Seeking temperatures of maximum density. J. Comput. Chem. 1998, 19, 1179–1186. [Google Scholar] [CrossRef]
- Jorgensen, W.L.; Madura, J.D. Temperature and size dependence for Monte Carlo simulations of TIP4P water. Mol. Phys. 1985, 56, 1381–1392. [Google Scholar] [CrossRef]
- Ooi, T.; Oobatake, M.; Nemethy, G.; Scheraga, H.A. Accessible surface areas as a measure of the thermodynamic parameters of hydration of peptides. Proc. Natl. Acad. Sci. USA 1987, 84, 3086–3090. [Google Scholar] [CrossRef] [Green Version]
- Elcock, A.H. The stability of salt bridges at high temperatures: Implications for hyperthermophilic proteins. J. Mol. Biol. 1998, 284, 489–502. [Google Scholar] [CrossRef]
- Ansari, H.R.; Raghava, G.P. Identification of conformational B-cell Epitopes in an antigen from its primary sequence. Immunome Res. 2010, 6, 6. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kim, Y.; Ponomarenko, J.; Zhu, Z.; Tamang, D.; Wang, P.; Greenbaum, J.; Lundegaard, C.; Sette, A.; Lund, O.; Bourne, P.E. Immune epitope database analysis resource. Nucleic Acids Res. 2012, 40, W525–W530. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kringelum, J.V.; Lundegaard, C.; Lund, O.; Nielsen, M. Reliable B cell epitope predictions: Impacts of method development and improved benchmarking. PLoS Comput. Biol. 2012, 8, e1002829. [Google Scholar] [CrossRef] [PubMed]
Temperature | RMSD | RMSF | Rg | SASA | Hb |
---|---|---|---|---|---|
300 K | 0.30 ± 0.01 | 0.07 ± 0.03 | 1.37 ± 0.01 | 69.96 ± 1.24 | 83 ± 4.4 |
350 K | 0.38 ± 0.02 | 0.11 ± 0.07 | 1.39 ± 0.01 | 71.99 ± 1.69 | 81 ± 4.5 |
400 K | 0.51 ± 0.02 | 0.17 ± 0.09 | 1.40 ± 0.02 | 73.88 ± 1.95 | 74 ± 4.9 |
450 K | 0.93 ± 0.07 | 0.44 ± 0.22 | 1.45 ± 0.04 | 80.87 ± 4.67 | 69 ± 6.7 |
500 K | 1.55 ± 0.09 | 0.86 ± 0.21 | 1.61 ± 0.13 | 89.40 ± 6.31 | 70 ± 8.3 |
Frame | 300 K | 350 K | 400 K | 450 K | 500 K | |||||
---|---|---|---|---|---|---|---|---|---|---|
SB | d | SB | d | SB | d | SB | d | SB | d | |
180 ns | GLU108-LYS86 | 2.6 | GLU46-LYS43 | 2.4 | GLU45-LYS43 | 2.7 | GLU108-LYS86 | 2.6 | ASP29-LYS96 | 3.4 |
GLU78-ARG84 | 4.6 | GLU9-ARG19 | 4.1 | GLU16-ARG19 | 3.6 | ASP107-ARG19 | 4.6 | GLU108-LYS86 | 3.6 | |
GLU120-LYS95 | 2.7 | ASP53-LYS96 | 3.5 | GLU120-LYS95 | 2.8 | ASP128-ARG121 | 4.1 | GLU56-HIS28 | 4.5 | |
GLU46-LYS43 | 3.4 | GLU16-ARG121 | 4.6 | GLU78-ARG84 | 4.0 | GLU45-LYS43 | 3.6 | GLU45-LYS43 | 3.0 | |
GLU9-ARG19 | 4.4 | GLU78-ARG84 | 3.3 | GLU14-ARG19 | 3.3 | GLU56-LYS96 | 2.8 | GLU46-LYS71 | 3.5 | |
ASP53-LYS96 | 3.2 | ASP124-ARG121 | 4.4 | GLU120-LYS86 | 3.9 | |||||
GLU56-LYS96 | 2.6 | GLU56-HIS28 | 4.8 | GLU16-LYS95 | 3.4 | |||||
ASP53-HIS28 | 4.8 | GLU46-LYS87 | 3.1 | GLU78-LYS96 | 3.5 | |||||
GLU108-ARG84 | 3.9 | |||||||||
185 ns | GLU108-LYS86 | 3.1 | GLU108-ARG84 | 3.8 | GLU45-LYS43 | 2.7 | ASP53-ARG84 | 3.2 | GLU45-LYS71 | 3.1 |
GLU46-LYS43 | 2.7 | GLU9-ARG19 | 4.4 | GLU108-ARG84 | 4.0 | GLU45-LYS43 | 3.2 | GLU108-ARG84 | 3.3 | |
GLU9-ARG19 | 4.3 | GLU46-LYS43 | 3.1 | GLU120-LYS95 | 3.1 | ASP107-LYS71 | 2.9 | GLU45-LYS43 | 3.6 | |
GLU120-LYS95 | 3.0 | ASP53-LYS96 | 3.7 | GLU78-ARG84 | 4.0 | GLU56-LYS96 | 3.7 | GLU56-LYS43 | 3.4 | |
GLU56-LYS96 | 3.0 | GLU108-LYS86 | 3.2 | ASP128-LYS86 | 3.8 | |||||
ASP107-ARG19 | 4.7 | GLU78-ARG84 | 3.7 | ASP53-LYS71 | 3.3 | |||||
GLU14-ARG19 | 3.2 | ASP8-HIS10 | 4.1 | GLU78-LYS96 | 2.5 | |||||
ASP124-ARG121 | 4.5 | ASP107-ARG19 | 4.5 | GLU78-ARG121 | 4.4 | |||||
GLU9-HIS10 | 3.8 | GLU56-HIS28 | 4.5 | ASP128-LYS87 | 3.4 | |||||
GLU16-ARG19 | 3.4 | GLU120-LYS87 | 3.2 | |||||||
190 ns | GLU108-LYS86 | 2.6 | GLU16-ARG121 | 4.7 | GLU45-LYS43 | 3.3 | ASP107-LYS71 | 2.5 | ASP128-LYS87 | 3.3 |
GLU9-ARG19 | 4.2 | GLU46-LYS43 | 2.7 | GLU108-ARG84 | 3.8 | ASP128-ARG19 | 3.6 | GLU78-ARG121 | 3.5 | |
GLU78-ARG84 | 4.4 | GLU9-ARG19 | 5.0 | GLU108-LYS86 | 3.5 | GLU78-ARG84 | 3.5 | ASP128-LYS86 | 3.0 | |
GLU120-LYS95 | 3.0 | ASP53-LYS96 | 3.6 | GLU120-LYS95 | 2.7 | ASP53-ARG84 | 4.2 | GLU14-LYS95 | 2.9 | |
GLU108-ARG84 | 3.6 | GLU78-ARG84 | 4.3 | GLU108-LYS86 | 3.5 | GLU46-LYS71 | 2.7 | |||
GLU16-ARG19 | 3.5 | GLU78-LYS87 | 2.9 | GLU9-HIS10 | 3.9 | |||||
GLU14-ARG19 | 3.3 | GLU16-ARG121 | 3.3 | GLU120-LYS86 | 3.1 | |||||
ASP124-ARG121 | 4.8 | GLU120-LYS87 | 3.1 | |||||||
GLU78-LYS96 | 3.6 | |||||||||
195 ns | GLU108-LYS86 | 2.7 | GLU9-ARG19 | 3.4 | GLU45-LYS43 | 3.4 | GLU120-ARG121 | 3.3 | GLU9-LYS71 | 2.8 |
GLU9-ARG19 | 4.5 | GLU108-LYS86 | 3.4 | ASP124-ARG121 | 3.5 | GLU78-LYS87 | 3.6 | GLU120-LYS87 | 3.1 | |
GLU78-ARG84 | 4.5 | GLU46-LYS43 | 3.1 | GLU108-ARG84 | 4.2 | ASP107-LYS71 | 3.1 | ASP128-LYS87 | 3.3 | |
GLU120-LYS95 | 3.4 | ASP53-LYS96 | 3.7 | GLU78-ARG84 | 4.2 | GLU56-LYS96 | 3.1 | ASP29-LYS96 | 4.1 | |
GLU108-ARG84 | 4.3 | GLU14-ARG19 | 3.3 | GLU108-LYS86 | 3.8 | GLU16-ARG19 | 4.1 | |||
ASP53-LYS96 | 3.7 | ASP128-ARG19 | 3.6 | ASP128-LYS86 | 3.1 | |||||
GLU9-HIS10 | 4.4 | GLU56-HIS28 | 4.5 | GLU46-LYS43 | 3.7 | |||||
GLU16-ARG19 | 3.2 | ASP124-ARG19 | 3.6 | ASP8-LYS95 | 3.3 | |||||
GLU120-LYS95 | 3.2 | GLU78-ARG84 | 4.4 | ASP124-ARG121 | 4.3 | |||||
GLU120-LYS86 | 2.9 | |||||||||
GLU78-LYS96 | 3.9 | |||||||||
200 ns | GLU108-LYS86 | 2.7 | GLU46-LYS43 | 2.6 | GLU78-ARG84 | 4.4 | GLU78-ARG84 | 3.3 | GLU120-LYS87 | 2.5 |
GLU9-ARG19 | 4.4 | ASP53-LYS96 | 3.4 | GLU14-ARG19 | 3.3 | ASP107-LYS71 | 3.2 | ASP29-LYS96 | 2.5 | |
GLU120-LYS95 | 3.0 | GLU108-ARG84 | 3.9 | GLU108-LYS86 | 3.3 | GLU108-LYS86 | 3.1 | ASP8-LYS95 | 2.9 | |
GLU45-LYS43 | 2.7 | GLU45-LYS43 | 3.6 | GLU45-LYS43 | 3.3 | |||||
ASP53-LYS96 | 3.6 | ASP53-LYS43 | 2.5 | ASP128-LYS86 | 3.5 | |||||
GLU16-ARG19 | 3.3 | GLU56-LYS43 | 3.3 | GLU14-LYS71 | 3.2 | |||||
GLU108-ARG84 | 4.1 | ASP124-ARG19 | 3.5 | |||||||
GLU120-LYS95 | 3.3 | GLU120-LYS95 | 3.4 |
Start | End | Peptide | N.residues | Score * |
---|---|---|---|---|
300 K | ||||
124 | 130 | DYLIDQG | 7 | 0.7 |
40 | 46 | PQLKPEE | 7 | 0.7 |
1 | 10 | MSWQAYGDEH | 10 | 0.7 |
87 | 90 | KGPG | 4 | 0.6 |
107 | 115 | DEPMTPGQC | 9 | 0.6 |
51 | 81 | MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGA | 31 | 0.6 |
13 | 20 | CEIEGNRL | 8 | 0.6 |
350 K | ||||
40 | 47 | PQLKPEEI | 8 | 0.7 |
52 | 64 | NDFNEPGSLAPTG | 13 | 0.7 |
1 | 10 | MSWQAYGDEH | 10 | 0.7 |
107 | 117 | DEPMTPGQCNM | 11 | 0.7 |
86 | 89 | KKGP | 4 | 0.6 |
123 | 130 | GDYLIDQG | 8 | 0.6 |
68 | 81 | GGTKYMVIQGEPGA | 14 | 0.6 |
13 | 20 | CEIEGNRL | 8 | 0.6 |
27 | 31 | GHDGS | 5 | 0.5 |
400 K | ||||
123 | 130 | GDYLIDQG | 8 | 0.8 |
108 | 114 | EPMTPGQ | 7 | 0.7 |
44 | 64 | PEEITGVMNDFNEPGSLAPTG | 21 | 0.6 |
76 | 81 | QGEPGA | 6 | 0.6 |
1 | 19 | MSWQAYGDEHLMCEIEGNR | 19 | 0.6 |
28 | 33 | HDGSVW | 6 | 0.6 |
69 | 73 | GTKYM | 5 | 0.5 |
450 K | ||||
125 | 130 | YLIDQG | 6 | 0.8 |
68 | 72 | GGTKY | 5 | 0.7 |
1 | 17 | MSWQAYGDEHLMCEIEG | 17 | 0.7 |
41 | 60 | QLKPEEITGVMNDFNEPGSL | 20 | 0.7 |
107 | 117 | DEPMTPGQCNM | 11 | 0.6 |
27 | 30 | GHDG | 4 | 0.6 |
78 | 89 | EPGAVIRGKKGP | 12 | 0.5 |
500 K | ||||
1 | 7 | MSWQAYG | 7 | 0.8 |
47 | 66 | ITGVMNDFNEPGSLAPTGLY | 20 | 0.8 |
107 | 126 | DEPMTPGQCNMIVERLGDYL | 20 | 0.7 |
29 | 40 | DGSVWAQSSTFP | 12 | 0.6 |
76 | 80 | QGEPG | 5 | 0.5 |
© 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Barazorda-Ccahuana, H.L.; Theiss-De-Rosso, V.; Valencia, D.E.; Gómez, B. Heat-Stable Hazelnut Profilin: Molecular Dynamics Simulations and Immunoinformatics Analysis. Polymers 2020, 12, 1742. https://0-doi-org.brum.beds.ac.uk/10.3390/polym12081742
Barazorda-Ccahuana HL, Theiss-De-Rosso V, Valencia DE, Gómez B. Heat-Stable Hazelnut Profilin: Molecular Dynamics Simulations and Immunoinformatics Analysis. Polymers. 2020; 12(8):1742. https://0-doi-org.brum.beds.ac.uk/10.3390/polym12081742
Chicago/Turabian StyleBarazorda-Ccahuana, Haruna L., Vinicius Theiss-De-Rosso, Diego Ernesto Valencia, and Badhin Gómez. 2020. "Heat-Stable Hazelnut Profilin: Molecular Dynamics Simulations and Immunoinformatics Analysis" Polymers 12, no. 8: 1742. https://0-doi-org.brum.beds.ac.uk/10.3390/polym12081742